• Gene id: 56896

Gene Summary

• Gene Symbol: DPYSL5   Gene   UCSC   Ensembl
• Aliases: CRAM, CRMP-5, CRMP5, CV2, Ulip6
• Gene name: dihydropyrimidinase like 5
• Alternate names: dihydropyrimidinase-related protein 5, CRMP3-associated molecule, DRP-5, ULIP-6, UNC33-like phosphoprotein 6, collapsin response mediator protein-5,
• Gene location: 2p23.3 (26848101: 26950350)     Exons: 16     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the CRMP (collapsing response mediator protein) family thought to be involved in neural development. Antibodies to the encoded protein were found in some patients with neurologic symptoms who had paraneoplastic syndrome. A ps
• OMIM: 608383

Protein Summary

• Protein general information: Q9BPU6  
  • Name: Dihydropyrimidinase related protein 5 (DRP 5) (CRMP3 associated molecule) (CRAM) (Collapsin response mediator protein 5) (CRMP 5) (UNC33 like phosphoprotein 6) (ULIP 6)
  • Length: 564  
  • Mass: 61421
• Sequence:

  MLANSASVRILIKGGKVVNDDCTHEADVYIENGIIQQVGRELMIPGGAKVIDATGKLVIPGGIDTSTHFHQTFMN
  ATCVDDFYHGTKAALVGGTTMIIGHVLPDKETSLVDAYEKCRGLADPKVCCDYALHVGITWWAPKVKAEMETLVR
  EKGVNSFQMFMTYKDLYMLRDSELYQVLHACKDIGAIARVHAENGELVAEGAKEALDLGITGPEGIEISRPEELE
  AEATHRVITIANRTHCPIYLVNVSSISAGDVIAAAKMQGKVVLAETTTAHATLTGLHYYHQDWSHAAAYVTVPPL
  RLDTNTSTYLMSLLANDTLNIVASDHRPFTTKQKAMGKEDFTKIPHGVSGVQDRMSVIWERGVVGGKMDENRFVA
  VTSSNAAKLLNLYPRKGRIIPGADADVVVWDPEATKTISASTQVQGGDFNLYENMRCHGVPLVTISRGRVVYENG
  VFMCAEGTGKFCPLRSFPDTVYKKLVQREKTLKVRGVDRTPYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGM
  RDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW

• Structural information:
  • Interpro: IPR006680  IPR030626  IPR011778  IPR011059  IPR032466  
  • CDD: cd01314
  • PDB: 4B90 4B91 4B92
  • PDBsum: 4B90 4B91 4B92
  • STRING: ENSP00000288699
• Other Databases: GeneCards:  DPYSL5  Malacards:  DPYSL5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004157	dihydropyrimidinase activity	IBA	NOT|molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0006208	pyrimidine nucleobase catabolic process	IBA	NOT|biological process
GO:0016812	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides	IBA	molecular function
GO:0008017	microtubule binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016810	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007399	nervous system development	TAS	biological process
GO:0007411	axon guidance	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R