• Gene id: 56895

Gene Summary

• Gene Symbol: AGPAT4   Gene   UCSC   Ensembl
• Aliases: 1-AGPAT4, LPAAT-delta, dJ473J16.2
• Gene name: 1-acylglycerol-3-phosphate O-acyltransferase 4
• Alternate names: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta, 1-AGP acyltransferase 4, 1-AGPAT 4, 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta), lysophosphatidic acid acyltransferase delta, lysophosphatidic acid acyltran,
• Gene location: 6q26 (161274107: 161129966)     Exons: 10     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. [provided by RefSeq, Jul 2008]
• OMIM: 614795

Protein Summary

• Protein general information: Q9NRZ5  
  • Name: 1 acyl sn glycerol 3 phosphate acyltransferase delta (EC 2.3.1.51) (1 acylglycerol 3 phosphate O acyltransferase 4) (1 AGP acyltransferase 4) (1 AGPAT 4) (Lysophosphatidic acid acyltransferase delta) (LPAAT delta)
  • Length: 378  
  • Mass: 44021
  • Tissue specificity: Widely expressed with highest levels in skeletal muscle, followed by heart, liver, prostate and thymus. {ECO
• Sequence:

  MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTI
  FTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQ
  DRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAV
  YDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMV
  PPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYGNSDSKQK
  LND

• Structural information:
  • Interpro: IPR032098  IPR002123  
  • STRING: ENSP00000314036
• Other Databases: GeneCards:  AGPAT4  Malacards:  AGPAT4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016746	transferase activity, transferring acyl groups	IBA	molecular function
GO:0012505	endomembrane system	IBA	cellular component
GO:0005741	mitochondrial outer membrane	IBA	cellular component
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IBA	molecular function
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	ISS	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0042171	lysophosphatidic acid acyltransferase activity	IEA	molecular function
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IEA	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016024	CDP-diacylglycerol biosynthetic process	IEA	biological process
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	NAS	molecular function
GO:0008654	phospholipid biosynthetic process	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04072	Phospholipase D signaling pathway
hsa00564	Glycerophospholipid metabolism
hsa00561	Glycerolipid metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq