• Gene id: 56894

Gene Summary

• Gene Symbol: AGPAT3   Gene   UCSC   Ensembl
• Aliases: 1-AGPAT 3, LPAAT-GAMMA1, LPAAT3
• Gene name: 1-acylglycerol-3-phosphate O-acyltransferase 3
• Alternate names: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma, 1-AGP acyltransferase 3, lysophosphatidic acid acyltransferase gamma, lysophosphatidic acid acyltransferase-gamma1,
• Gene location: 21q22.3 (43865159: 43987591)     Exons: 6     NC_000021.9
• Gene summary(Entrez): The protein encoded by this gene is an acyltransferase that converts lysophosphatidic acid into phosphatidic acid, which is the second step in the de novo phospholipid biosynthetic pathway. The encoded protein may be an integral membrane protein. Two tran
• OMIM: 614794

Protein Summary

• Protein general information: Q9NRZ7  
  • Name: 1 acyl sn glycerol 3 phosphate acyltransferase gamma (EC 2.3.1.51) (1 acylglycerol 3 phosphate O acyltransferase 3) (1 AGP acyltransferase 3) (1 AGPAT 3) (Lysophosphatidic acid acyltransferase gamma) (LPAAT gamma)
  • Length: 376  
  • Mass: 43381
  • Tissue specificity: Widely expressed with highest levels in testis, pancreas and kidney, followed by spleen, lung, adipose tissue and liver. {ECO
• Sequence:

  MGLLAFLKTQFVLHLLVGFVFVVSGLVINFVQLCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTL
  FTDQATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRKWEE
  DRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLPRTKGFTTAVKCLRGTVAAV
  YDVTLNFRGNKNPSLLGILYGKKYEADMCVRRFPLEDIPLDEKEAAQWLHKLYQEKDALQEIYNQKGMFPGEQFK
  PARRPWTLLNFLSWATILLSPLFSFVLGVFASGSPLLILTFLGFVGAASFGVRRLIGVTEIEKGSSYGNQEFKKK
  E

• Structural information:
  • Interpro: IPR032098  IPR002123  
  • STRING: ENSP00000381140
• Other Databases: GeneCards:  AGPAT3  Malacards:  AGPAT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016746	transferase activity, transferring acyl groups	IBA	molecular function
GO:0012505	endomembrane system	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IBA	molecular function
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IDA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IEA	molecular function
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	TAS	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042171	lysophosphatidic acid acyltransferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0016024	CDP-diacylglycerol biosynthetic process	IEA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0005886	plasma membrane	HDA	cellular component
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	NAS	molecular function
GO:0005783	endoplasmic reticulum	HDA	cellular component
GO:0008654	phospholipid biosynthetic process	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04072	Phospholipase D signaling pathway
hsa00564	Glycerophospholipid metabolism
hsa00561	Glycerolipid metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray