Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 5689
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol PSMB1   Gene   UCSC   Ensembl
Aliases HC5, PMSB1, PSC5
Gene name proteasome 20S subunit beta 1
Alternate names proteasome subunit beta type-1, macropain subunit C5, multicatalytic endopeptidase complex subunit C5, proteasome (prosome, macropain) subunit, beta type, 1, proteasome beta 1 subunit, proteasome component C5, proteasome gamma chain, proteasome subunit HC5, prote,
Gene location 6q27 (170553306: 170535119)     Exons: 6     NC_000006.12
Gene summary(Entrez) The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta
OMIM 602017

Protein Summary
Protein general information P20618  

Name: Proteasome subunit beta type 1 (EC 3.4.25.1) (Macropain subunit C5) (Multicatalytic endopeptidase complex subunit C5) (Proteasome component C5) (Proteasome gamma chain)

Length: 241  Mass: 26489

Sequence MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLT
DKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVY
SFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICI
VTKEGIREETVSLRKD
Structural information
Interpro:  IPR029055  IPR035202  IPR016050  IPR001353  IPR023333  
Prosite:   PS00854 PS51476

PDB:  		 4R3O 4R67 5A0Q 5GJQ 5GJR 5L4G 5L5B 5L5D 5L5E 5L5F 5L5H 5L5I 5L5J 5L5O 5L5P 5L5Q 5L5R 5L5S 5L5T 5L5U 5L5V 5L5W 5L5X 5L5Y 5L5Z 5L60 5L61 5L62 5L63 5L64 5LE5 5LEX 5LEY 5LEZ 5LF0 5LF1 5LF3 5LF4 5LF6 5LF7 5LN3 5M2B 5M32 5T0C 5T0G 5T0H 5T0I 5T0J 5VFO 5VFP 5VFQ 5VFR 5VFS 5VFT 5VFU 6AVO 6E5B 6MSB 6MSD 6MSE 6MSG 6MSH 6MSJ 6MS
PDBsum:   4R3O 4R67 5A0Q 5GJQ 5GJR 5L4G 5L5B 5L5D 5L5E 5L5F 5L5H 5L5I 5L5J 5L5O 5L5P 5L5Q 5L5R 5L5S 5L5T 5L5U 5L5V 5L5W 5L5X 5L5Y 5L5Z 5L60 5L61 5L62 5L63 5L64 5LE5 5LEX 5LEY 5LEZ 5LF0 5LF1 5LF3 5LF4 5LF6 5LF7 5LN3 5M2B 5M32 5T0C 5T0G 5T0H 5T0I 5T0J 5VFO 5VFP 5VFQ 5VFR 5VFS 5VFT 5VFU 6AVO 6E5B 6MSB 6MSD 6MSE 6MSG 6MSH 6MSJ 6MS

DIP:  
31193
MINT:  
STRING:   ENSP00000262193
Other Databases GeneCards:  PSMB1  Malacards:  PSMB1

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0043161 proteasome-mediated ubiqu
itin-dependent protein ca
tabolic process
 IBA biological process
GO:0005839 proteasome core complex
 IBA cellular component
GO:0005737 cytoplasm
 IBA cellular component
GO:0005634 nucleus
 IBA cellular component
GO:0004175 endopeptidase activity
 IBA molecular function
GO:0010499 proteasomal ubiquitin-ind
ependent protein cataboli
c process
 IBA biological process
GO:0010498 proteasomal protein catab
olic process
 IBA biological process
GO:0019774 proteasome core complex,
beta-subunit complex
 ISS cellular component
GO:0005839 proteasome core complex
 ISS cellular component
GO:0004298 threonine-type endopeptid
ase activity
 IEA molecular function
GO:0051603 proteolysis involved in c
ellular protein catabolic
process
 IEA biological process
GO:0004175 endopeptidase activity
 IEA molecular function
GO:0005839 proteasome core complex
 IEA cellular component
GO:0006508 proteolysis
 IEA biological process
GO:0004298 threonine-type endopeptid
ase activity
 IEA molecular function
GO:0008233 peptidase activity
 IEA molecular function
GO:0016787 hydrolase activity
 IEA molecular function
GO:0000502 proteasome complex
 IEA cellular component
GO:0016032 viral process
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0000502 proteasome complex
 TAS cellular component
GO:0000165 MAPK cascade
 TAS biological process
GO:0000209 protein polyubiquitinatio
n
 TAS biological process
GO:0006521 regulation of cellular am
ino acid metabolic proces
s
 TAS biological process
GO:0010972 negative regulation of G2
/M transition of mitotic
cell cycle
 TAS biological process
GO:0016579 protein deubiquitination
 TAS biological process
GO:0031145 anaphase-promoting comple
x-dependent catabolic pro
cess
 TAS biological process
GO:0031145 anaphase-promoting comple
x-dependent catabolic pro
cess
 TAS biological process
GO:0031145 anaphase-promoting comple
x-dependent catabolic pro
cess
 TAS biological process
GO:0031146 SCF-dependent proteasomal
ubiquitin-dependent prot
ein catabolic process
 TAS biological process
GO:0038061 NIK/NF-kappaB signaling
 TAS biological process
GO:0043161 proteasome-mediated ubiqu
itin-dependent protein ca
tabolic process
 TAS biological process
GO:0043161 proteasome-mediated ubiqu
itin-dependent protein ca
tabolic process
 TAS biological process
GO:0043161 proteasome-mediated ubiqu
itin-dependent protein ca
tabolic process
 TAS biological process
GO:0043312 neutrophil degranulation
 TAS biological process
GO:0050852 T cell receptor signaling
pathway
 TAS biological process
GO:0055085 transmembrane transport
 TAS biological process
GO:0060071 Wnt signaling pathway, pl
anar cell polarity pathwa
y
 TAS biological process
GO:0070498 interleukin-1-mediated si
gnaling pathway
 TAS biological process
GO:0090090 negative regulation of ca
nonical Wnt signaling pat
hway
 TAS biological process
GO:0090263 positive regulation of ca
nonical Wnt signaling pat
hway
 TAS biological process
GO:1904813 ficolin-1-rich granule lu
men
 TAS cellular component
GO:0002223 stimulatory C-type lectin
receptor signaling pathw
ay
 TAS biological process
GO:0002479 antigen processing and pr
esentation of exogenous p
eptide antigen via MHC cl
ass I, TAP-dependent
 TAS biological process
GO:0005576 extracellular region
 TAS cellular component
GO:0005576 extracellular region
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0033209 tumor necrosis factor-med
iated signaling pathway
 TAS biological process
GO:0034774 secretory granule lumen
 TAS cellular component
GO:0038095 Fc-epsilon receptor signa
ling pathway
 TAS biological process
GO:0043488 regulation of mRNA stabil
ity
 TAS biological process
GO:0043687 post-translational protei
n modification
 TAS biological process
GO:0061418 regulation of transcripti
on from RNA polymerase II
promoter in response to
hypoxia
 TAS biological process
GO:1901990 regulation of mitotic cel
l cycle phase transition
 TAS biological process
GO:1902036 regulation of hematopoiet
ic stem cell differentiat
ion
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005839 proteasome core complex
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0000502 proteasome complex
 IDA cellular component
GO:0070062 extracellular exosome
 HDA cellular component
GO:0005634 nucleus
 HDA cellular component
GO:0070062 extracellular exosome
 HDA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05010Alzheimer disease
hsa05016Huntington disease
hsa05012Parkinson disease
hsa05017Spinocerebellar ataxia
hsa03050Proteasome

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract