• Gene id: 56886

Gene Summary

• Gene Symbol: UGGT1   Gene   UCSC   Ensembl
• Aliases: HUGT1, UGCGL1, UGT1
• Gene name: UDP-glucose glycoprotein glucosyltransferase 1
• Alternate names: UDP-glucose:glycoprotein glucosyltransferase 1, UDP--Glc:glycoprotein glucosyltransferase, UDP-glucose ceramide glucosyltransferase-like 1,
• Gene location: 2q14.3 (128091183: 128195676)     Exons: 44     NC_000002.12
• Gene summary(Entrez): UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.[supplied by OMIM, Oct 200
• OMIM: 612510

Protein Summary

• Protein general information: Q9NYU2  
  • Name: UDP glucose:glycoprotein glucosyltransferase 1 (UGT1) (hUGT1) (EC 2.4.1. ) (UDP Glc:glycoprotein glucosyltransferase) (UDP glucose ceramide glucosyltransferase like 1)
  • Length: 1555  
  • Mass: 177190
  • Tissue specificity: Higher levels in pancreas, skeletal muscle, kidney, and brain. Low levels in lung and heart. {ECO
• Sequence:

  MGCKGDASGACAAGALPVTGVCYKMGVLVVLTVLWLFSSVKADSKAITTSLTTKWFSTPLLLEASEFLAEDSQEK
  FWNFVEASQNIGSSDHDGTDYSYYHAILEAAFQFLSPLQQNLFKFCLSLRSYSATIQAFQQIAADEPPPEGCNSF
  FSVHGKKTCESDTLEALLLTASERPKPLLFKGDHRYPSSNPESPVVIFYSEIGSEEFSNFHRQLISKSNAGKINY
  VFRHYIFNPRKEPVYLSGYGVELAIKSTEYKAKDDTQVKGTEVNTTVIGENDPIDEVQGFLFGKLRDLHPDLEGQ
  LKELRKHLVESTNEMAPLKVWQLQDLSFQTAARILASPVELALVVMKDLSQNFPTKARAITKTAVSSELRTEVEE
  NQKYFKGTLGLQPGDSALFINGLHMDLDTQDIFSLFDVLRNEARVMEGLHRLGIEGLSLHNVLKLNIQPSEADYA
  VDIRSPAISWVNNLEVDSRYNSWPSSLQELLRPTFPGVIRQIRKNLHNMVFIVDPAHETTAELMNTAEMFLSNHI
  PLRIGFIFVVNDSEDVDGMQDAGVAVLRAYNYVAQEVDDYHAFQTLTHIYNKVRTGEKVKVEHVVSVLEKKYPYV
  EVNSILGIDSAYDRNRKEARGYYEQTGVGPLPVVLFNGMPFEREQLDPDELETITMHKILETTTFFQRAVYLGEL
  PHDQDVVEYIMNQPNVVPRINSRILTAERDYLDLTASNNFFVDDYARFTILDSQGKTAAVANSMNYLTKKGMSSK
  EIYDDSFIRPVTFWIVGDFDSPSGRQLLYDAIKHQKSSNNVRISMINNPAKEISYENTQISRAIWAALQTQTSNA
  AKNFITKMAKEGAAEALAAGADIAEFSVGGMDFSLFKEVFESSKMDFILSHAVYCRDVLKLKKGQRAVISNGRII
  GPLEDSELFNQDDFHLLENIILKTSGQKIKSHIQQLRVEEDVASDLVMKVDALLSAQPKGDPRIEYQFFEDRHSA
  IKLRPKEGETYFDVVAVVDPVTREAQRLAPLLLVLAQLINMNLRVFMNCQSKLSDMPLKSFYRYVLEPEISFTSD
  NSFAKGPIAKFLDMPQSPLFTLNLNTPESWMVESVRTPYDLDNIYLEEVDSVVAAEYELEYLLLEGHCYDITTGQ
  PPRGLQFTLGTSANPVIVDTIVMANLGYFQLKANPGAWILRLRKGRSEDIYRIYSHDGTDSPPDADEVVIVLNNF
  KSKIIKVKVQKKADMVNEDLLSDGTSENESGFWDSFKWGFTGQKTEEVKQDKDDIINIFSVASGHLYERFLRIMM
  LSVLKNTKTPVKFWFLKNYLSPTFKEFIPYMANEYNFQYELVQYKWPRWLHQQTEKQRIIWGYKILFLDVLFPLV
  VDKFLFVDADQIVRTDLKELRDFNLDGAPYGYTPFCDSRREMDGYRFWKSGYWASHLAGRKYHISALYVVDLKKF
  RKIAAGDRLRGQYQGLSQDPNSLSNLDQDLPNNMIHQVPIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKE
  PKLEAAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREEL

• Structural information:
  • Interpro: IPR040497  IPR029044  IPR009448  IPR040693  IPR040694   IPR040692  IPR040525  
  • Prosite: PS00014
  • STRING: ENSP00000259253
• Other Databases: GeneCards:  UGGT1  Malacards:  UGGT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0051082	unfolded protein binding	IBA	molecular function
GO:0071712	ER-associated misfolded protein catabolic process	IBA	biological process
GO:0003980	UDP-glucose:glycoprotein glucosyltransferase activity	IBA	molecular function
GO:0018279	protein N-linked glycosylation via asparagine	IBA	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0003980	UDP-glucose:glycoprotein glucosyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:1904380	endoplasmic reticulum mannose trimming	TAS	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0003980	UDP-glucose:glycoprotein glucosyltransferase activity	IEA	molecular function
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IEA	cellular component
GO:0044322	endoplasmic reticulum quality control compartment	IEA	cellular component
GO:0097359	UDP-glucosylation	IEA	biological process
GO:0097359	UDP-glucosylation	IEA	biological process
GO:0097359	UDP-glucosylation	IEA	biological process
GO:0097359	UDP-glucosylation	IEA	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0003980	UDP-glucose:glycoprotein glucosyltransferase activity	IDA	molecular function
GO:0051082	unfolded protein binding	IDA	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0051084	'de novo' posttranslational protein folding	TAS	biological process
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0051082	unfolded protein binding	IBA	molecular function
GO:0071712	ER-associated misfolded protein catabolic process	IBA	biological process
GO:0003980	UDP-glucose:glycoprotein glucosyltransferase activity	IBA	molecular function
GO:0018279	protein N-linked glycosylation via asparagine	IBA	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0003980	UDP-glucose:glycoprotein glucosyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:1904380	endoplasmic reticulum mannose trimming	TAS	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0003980	UDP-glucose:glycoprotein glucosyltransferase activity	IEA	molecular function
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IEA	cellular component
GO:0044322	endoplasmic reticulum quality control compartment	IEA	cellular component
GO:0097359	UDP-glucosylation	IEA	biological process
GO:0097359	UDP-glucosylation	IEA	biological process
GO:0097359	UDP-glucosylation	IEA	biological process
GO:0097359	UDP-glucosylation	IEA	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0003980	UDP-glucose:glycoprotein glucosyltransferase activity	IDA	molecular function
GO:0051082	unfolded protein binding	IDA	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0051084	'de novo' posttranslational protein folding	TAS	biological process
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881