• Gene id: 56852

Gene Summary

• Gene Symbol: RAD18   Gene   UCSC   Ensembl
• Aliases: RNF73
• Gene name: RAD18 E3 ubiquitin protein ligase
• Alternate names: E3 ubiquitin-protein ligase RAD18, RAD18 homolog, RAD18, S. cerevisiae, homolog, RING finger protein 73, RING-type E3 ubiquitin transferase RAD18, hHR18, hRAD18, postreplication repair protein RAD18, postreplication repair protein hRAD18p,
• Gene location: 3p25.3 (8969248: 8877074)     Exons: 14     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Sim
• OMIM: 605440

Protein Summary

• Protein general information: Q9NS91  
  • Name: E3 ubiquitin protein ligase RAD18 (EC 2.3.2.27) (Postreplication repair protein RAD18) (hHR18) (hRAD18) (RING finger protein 73) (RING type E3 ubiquitin transferase RAD18)
  • Length: 495  
  • Mass: 56223
• Sequence:

  MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNN
  RILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLI
  KENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLS
  REEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEI
  VREIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTIT
  KEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDL
  LEEEEAWEASHKNDLQDTEISPRQNRRTRAAESAEIEPRNKRNRN

• Structural information:
  • Protein Domains: (248..28-)
    (/note="SAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00186"-)
  • Interpro: IPR039577  IPR003034  IPR036361  IPR006642  IPR001841   IPR013083  IPR017907  
  • Prosite: PS50800 PS00518 PS50089 PS51908
  • PDB: 2MRE 2MRF 2Y43 2YBF 5VF0
  • PDBsum: 2MRE 2MRF 2Y43 2YBF 5VF0
  • DIP: 29831
  • STRING: ENSP00000264926
• Other Databases: GeneCards:  RAD18  Malacards:  RAD18

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017116	single-stranded DNA helicase activity	IBA	molecular function
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006301	postreplication repair	IBA	biological process
GO:0006513	protein monoubiquitination	IBA	biological process
GO:0009411	response to UV	IBA	biological process
GO:0097505	Rad6-Rad18 complex	IBA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0035861	site of double-strand break	IDA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0060548	negative regulation of cell death	IDA	biological process
GO:0031593	polyubiquitin modification-dependent protein binding	IDA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0042405	nuclear inclusion body	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0051984	positive regulation of chromosome segregation	IMP	biological process
GO:0044877	protein-containing complex binding	IPI	molecular function
GO:0044877	protein-containing complex binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003697	single-stranded DNA binding	IEA	molecular function
GO:0006301	postreplication repair	IEA	biological process
GO:0006513	protein monoubiquitination	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0042802	identical protein binding	IDA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0016567	protein ubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042769	DNA damage response, detection of DNA damage	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0032508	DNA duplex unwinding	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0000403	Y-form DNA binding	IDA	molecular function
GO:0005657	replication fork	IDA	cellular component
GO:0005634	nucleus	NAS	cellular component
GO:0003684	damaged DNA binding	NAS	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0006281	DNA repair	NAS	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq