• Gene id: 56849

Gene Summary

• Gene Symbol: TCEAL7   Gene   UCSC   Ensembl
• Aliases: WEX5
• Gene name: transcription elongation factor A like 7
• Alternate names: transcription elongation factor A protein-like 7, TCEA-like protein 7, transcription elongation factor A (SII)-like 7, transcription elongation factor S-II protein-like 7,
• Gene location: Xq22.2 (103330185: 103332325)     Exons: 3     NC_000023.11
• OMIM: 606283

Protein Summary

• Protein general information: Q9BRU2  
  • Name: Transcription elongation factor A protein like 7 (TCEA like protein 7) (Transcription elongation factor S II protein like 7)
  • Length: 100  
  • Mass: 12324
  • Tissue specificity: Highly expressed in normal and fetal brain tissues, and weakly expressed in uterus and ovary. Down-regulated in epithelial ovarian, cervical, prostate, breast, brain and lung cancer cell lines and in brain and ovarian tumors. {ECO
• Sequence:

  MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDEEMTREGDEMERCLEE
  IRGLRKKFRALHSNHRHSRDRPYPI

• Structural information:
  • Interpro: IPR021156  
  • STRING: ENSP00000329794
• Other Databases: GeneCards:  TCEAL7  Malacards:  TCEAL7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050699	WW domain binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881