• Gene id: 56848

Gene Summary

• Gene Symbol: SPHK2   Gene   UCSC   Ensembl
• Aliases: SK 2, SK-2, SPK 2, SPK-2
• Gene name: sphingosine kinase 2
• Alternate names: sphingosine kinase 2, sphingosine kinase type 2,
• Gene location: 19q13.33 (98134623: 98244896)     Exons: 16     NC_000010.11
• Gene summary(Entrez): This gene encodes one of two sphingosine kinase isozymes that catalyze the phosphorylation of sphingosine into sphingosine 1-phosphate. Sphingosine 1-phosphate mediates many cellular processes including migration, proliferation and apoptosis, and also pla
• OMIM: 607092

Protein Summary

• Protein general information: Q9NRA0  
  • Name: Sphingosine kinase 2 (SK 2) (SPK 2) (EC 2.7.1.91)
  • Length: 654  
  • Mass: 69217
  • Tissue specificity: Mainly expressed in adult kidney, liver, and brain (PubMed
• Sequence:

  MNGHLEAEEQQDQRPDQELTGSWGHGPRSTLVRAKAMAPPPPPLAASTPLLHGEFGSYPARGPRFALTLTSQALH
  IQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIYTYPRGRRGARRRATRTFRADGAATYEENRAEA
  QRWATALTCLLRGLPLPGDGEITPDLLPRPPRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNH
  ARELVQGLSLSEWDGIVTVSGDGLLHEVLNGLLDRPDWEEAVKMPVGILPCGSGNALAGAVNQHGGFEPALGLDL
  LLNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTLGTVLGLATLHTYRGR
  LSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSVSDLPLPLPQPALASPGSPEPLPILSLNGGG
  PELAGDWGGAGDAPLSPDPLLSSPPGSPKAALHSPVSEGAPVIPPSSGLPLPTPDARVGASTCGPPDHLLPPLGT
  PLPPDWVTLEGDFVLMLAISPSHLGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMERGSHFSLGCPQL
  GYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGIGTLLTGPPGCPGREP

• Structural information:
  • Protein Domains: (178..32-)
    (/note="DAGKc-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00783"-)
  • Interpro: IPR017438  IPR001206  IPR016064  
  • Prosite: PS50146
  • STRING: ENSP00000245222
• Other Databases: GeneCards:  SPHK2  Malacards:  SPHK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0006669	sphinganine-1-phosphate biosynthetic process	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0016310	phosphorylation	IBA	biological process
GO:0017050	D-erythro-sphingosine kinase activity	IBA	molecular function
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0001727	lipid kinase activity	IBA	molecular function
GO:0006665	sphingolipid metabolic process	IBA	biological process
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0046512	sphingosine biosynthetic process	IBA	biological process
GO:2000304	positive regulation of ceramide biosynthetic process	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043977	histone H2A-K5 acetylation	IDA	biological process
GO:0000786	nucleosome	IDA	cellular component
GO:0031064	negative regulation of histone deacetylation	IDA	biological process
GO:0045815	positive regulation of gene expression, epigenetic	IDA	biological process
GO:1901726	negative regulation of histone deacetylase activity	IDA	biological process
GO:0043980	histone H2B-K12 acetylation	IDA	biological process
GO:2000617	positive regulation of histone H3-K9 acetylation	IDA	biological process
GO:0031493	nucleosomal histone binding	IDA	molecular function
GO:1904628	cellular response to phorbol 13-acetate 12-myristate	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0017050	D-erythro-sphingosine kinase activity	IDA	molecular function
GO:0006669	sphinganine-1-phosphate biosynthetic process	IDA	biological process
GO:0006669	sphinganine-1-phosphate biosynthetic process	IDA	biological process
GO:0008481	sphinganine kinase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0030308	negative regulation of cell growth	ISS	biological process
GO:1904959	regulation of cytochrome-c oxidase activity	IMP	biological process
GO:0090280	positive regulation of calcium ion import	ISS	biological process
GO:0090037	positive regulation of protein kinase C signaling	ISS	biological process
GO:0072611	interleukin-13 secretion	ISS	biological process
GO:0043306	positive regulation of mast cell degranulation	ISS	biological process
GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling	ISS	biological process
GO:0005739	mitochondrion	ISS	cellular component
GO:2001169	regulation of ATP biosynthetic process	ISS	biological process
GO:1903426	regulation of reactive oxygen species biosynthetic process	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0033008	positive regulation of mast cell activation involved in immune response	ISS	biological process
GO:0002374	cytokine secretion involved in immune response	ISS	biological process
GO:1990774	tumor necrosis factor secretion	ISS	biological process
GO:0072604	interleukin-6 secretion	ISS	biological process
GO:0006670	sphingosine metabolic process	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003951	NAD+ kinase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008481	sphinganine kinase activity	IEA	molecular function
GO:0030148	sphingolipid biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007565	female pregnancy	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:1904959	regulation of cytochrome-c oxidase activity	IEA	biological process
GO:0090280	positive regulation of calcium ion import	IEA	biological process
GO:0090037	positive regulation of protein kinase C signaling	IEA	biological process
GO:0072611	interleukin-13 secretion	IEA	biological process
GO:0043306	positive regulation of mast cell degranulation	IEA	biological process
GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0030308	negative regulation of cell growth	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0006670	sphingosine metabolic process	IEA	biological process
GO:0006669	sphinganine-1-phosphate biosynthetic process	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0002374	cytokine secretion involved in immune response	IEA	biological process
GO:0001568	blood vessel development	IEA	biological process
GO:2001169	regulation of ATP biosynthetic process	IEA	biological process
GO:2000304	positive regulation of ceramide biosynthetic process	IEA	biological process
GO:1990774	tumor necrosis factor secretion	IEA	biological process
GO:1903426	regulation of reactive oxygen species biosynthetic process	IEA	biological process
GO:0072604	interleukin-6 secretion	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0033008	positive regulation of mast cell activation involved in immune response	IEA	biological process
GO:0017050	D-erythro-sphingosine kinase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0046834	lipid phosphorylation	IEA	biological process
GO:0046834	lipid phosphorylation	IEA	biological process
GO:0046834	lipid phosphorylation	IEA	biological process
GO:0003376	sphingosine-1-phosphate receptor signaling pathway	IEA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0017016	Ras GTPase binding	NAS	molecular function
GO:0005765	lysosomal membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0046512	sphingosine biosynthetic process	IGI	biological process
GO:0038036	sphingosine-1-phosphate receptor activity	IMP	molecular function
GO:0046512	sphingosine biosynthetic process	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04020	Calcium signaling pathway
hsa04072	Phospholipase D signaling pathway
hsa05152	Tuberculosis
hsa04371	Apelin signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04666	Fc gamma R-mediated phagocytosis
hsa00600	Sphingolipid metabolism
hsa04370	VEGF signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq