• Gene id: 56833

Gene Summary

• Gene Symbol: SLAMF8   Gene   UCSC   Ensembl
• Aliases: BLAME, CD353, SBBI42
• Gene name: SLAM family member 8
• Alternate names: SLAM family member 8, B lymphocyte activator macrophage expressed, BCM-like membrane protein,
• Gene location: 1q23.2 (48777488: 48727518)     Exons: 9     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the CD2 family of cell surface proteins involved in lymphocyte activation. These proteins are characterized by Ig domains. This protein is expressed in lymphoid tissues, and studies of a similar protein in mouse suggest that
• OMIM: 606620

Protein Summary

• Protein general information: Q9P0V8  
  • Name: SLAM family member 8 (B lymphocyte activator macrophage expressed) (BCM like membrane protein) (CD antigen CD353)
  • Length: 285  
  • Mass: 31670
  • Tissue specificity: Expressed in lymph node, spleen, thymus and bone marrow. {ECO
• Sequence:

  MVMRPLWSLLLWEALLPITVTGAQVLSKVGGSVLLVAARPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSR
  FLGRAQLHSNLSLELGPLESGDSGNFSVLMVDTRGQPWTQTLQLKVYDAVPRPVVQVFIAVERDAQPSKTCQVFL
  SCWAPNISEITYSWRRETTMDFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPWDSCHHEAA
  PGKASYKDVLLVVVPVSLLLMLVTLFSAWHWCPCSGKKKKDVHADRVGPETENPLVQDLP

• Structural information:
  • Protein Domains: (128..21-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  
  • Prosite: PS50835
  • STRING: ENSP00000289707
• Other Databases: GeneCards:  SLAMF8  Malacards:  SLAMF8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0009986	cell surface	NAS	cellular component
GO:0038023	signaling receptor activity	ISS	molecular function
GO:2000509	negative regulation of dendritic cell chemotaxis	ISS	biological process
GO:0060266	negative regulation of respiratory burst involved in inflammatory response	ISS	biological process
GO:0035690	cellular response to drug	ISS	biological process
GO:0042802	identical protein binding	ISS	molecular function
GO:0042742	defense response to bacterium	ISS	biological process
GO:0033860	regulation of NAD(P)H oxidase activity	ISS	biological process
GO:1902623	negative regulation of neutrophil migration	ISS	biological process
GO:0090027	negative regulation of monocyte chemotaxis	ISS	biological process
GO:0043549	regulation of kinase activity	ISS	biological process
GO:0010760	negative regulation of macrophage chemotaxis	ISS	biological process
GO:0002232	leukocyte chemotaxis involved in inflammatory response	ISS	biological process
GO:0045577	regulation of B cell differentiation	ISS	biological process
GO:0002336	B-1 B cell lineage commitment	ISS	biological process
GO:0090383	phagosome acidification	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881