• Gene id: 56829

Gene Summary

• Gene Symbol: ZC3HAV1   Gene   UCSC   Ensembl
• Aliases: ARTD13, FLB6421, PARP13, ZAP, ZC3H2, ZC3HDC2
• Gene name: zinc finger CCCH-type containing, antiviral 1
• Alternate names: zinc finger CCCH-type antiviral protein 1, ADP-ribosyltransferase diphtheria toxin-like 13, inactive Poly [ADP-ribose] polymerase 13, zinc finger CCCH domain-containing protein 2, zinc finger CCCH-type, antiviral 1,
• Gene location: 7q34 (139109719: 139043514)     Exons: 13     NC_000007.14
• Gene summary(Entrez): This gene encodes a CCCH-type zinc finger protein that is thought to prevent infection by retroviruses. Studies of the rat homolog indicate that the protein may primarily function to inhibit viral gene expression and induce an innate immunity to viral inf
• OMIM: 607312

Protein Summary

• Protein general information: Q7Z2W4  
  • Name: Zinc finger CCCH type antiviral protein 1 (ADP ribosyltransferase diphtheria toxin like 13) (ARTD13) (Inactive Poly [ADP ribose] polymerase 13) (PARP13) (Zinc finger CCCH domain containing protein 2) (Zinc finger antiviral protein) (ZAP)
  • Length: 902  
  • Mass: 101431
• Sequence:

  MADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVVLETGGEAGITRSVVATTRARVCRR
  KYCQRPCDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFKVLKNHELSGLNKEELAVLLLQSDPFFMPEIC
  KSYKGEGRQQICNQQPPCSRLHICDHFTRGNCRFPNCLRSHNLMDRKVLAIMREHGLNPDVVQNIQDICNSKHMQ
  KNPPGPRAPSSHRRNMAYRARSKSRDRFFQGSQEFLASASASAERSCTPSPDQISHRASLEDAPVDDLTRKFTYL
  GSQDRARPPSGSSKATDLGGTSQAGTSQRFLENGSQEDLLHGNPGSTYLASNSTSAPNWKSLTSWTNDQGARRKT
  VFSPTLPAARSSLGSLQTPEAVTTRKGTGLLSSDYRIINGKSGTQDIQPGPLFNNNADGVATDITSTRSLNYKST
  SSGHREISSPRIQDAGPASRDVQATGRIADDADPRVALVNDSLSDVTSTTSSRVDDHDSEEICLDHLCKGCPLNG
  SCSKVHFHLPYRWQMLIGKTWTDFEHMETIEKGYCNPGIHLCSVGSYTINFRVMSCDSFPIRRLSTPSSVTKPAN
  SVFTTKWIWYWKNESGTWIQYGEEKDKRKNSNVDSSYLESLYQSCPRGVVPFQAGSRNYELSFQGMIQTNIASKT
  QKDVIRRPTFVPQWYVQQMKRGPDHQPAKTSSVSLTATFRPQEDFCFLSSKKYKLSEIHHLHPEYVRVSEHFKAS
  MKNFKIEKIKKIENSELLDKFTWKKSQMKEEGKLLFYATSRAYVESICSNNFDSFLHETHENKYGKGIYFAKDAI
  YSHKNCPYDAKNVVMFVAQVLVGKFTEGNITYTSPPPQFDSCVDTRSNPSVFVIFQKDQVYPQYVIEYTEDKACV
  IS

• Structural information:
  • Protein Domains: (594..68-)
    (/note="WWE-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00248-)
    (716..90-)
    (/note="PARP-catalytic)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00397"-)
  • Interpro: IPR012317  IPR036388  IPR004170  IPR037197  IPR041360   IPR040954  IPR000571  
  • Prosite: PS51059 PS50918 PS50103
  • PDB: 2X5Y 4X52 6UEI 6UEJ
  • PDBsum: 2X5Y 4X52 6UEI 6UEJ
  • DIP: 37896
  • STRING: ENSP00000242351
• Other Databases: GeneCards:  ZC3HAV1  Malacards:  ZC3HAV1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0006471	protein ADP-ribosylation	IDA	NOT|biological process
GO:1990404	protein ADP-ribosylase activity	IDA	NOT|molecular function
GO:0061014	positive regulation of mRNA catabolic process	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006471	protein ADP-ribosylation	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0070403	NAD+ binding	IMP	NOT|molecular function
GO:0003950	NAD+ ADP-ribosyltransferase activity	IMP	NOT|molecular function
GO:0070212	protein poly-ADP-ribosylation	IMP	NOT|biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq