• Gene id: 5676

Gene Summary

• Gene Symbol: PSG7   Gene   UCSC   Ensembl
• Aliases: PSBG-7, PSG1, PSGGA
• Gene name: pregnancy specific beta-1-glycoprotein 7
• Alternate names: putative pregnancy-specific beta-1-glycoprotein 7, PS-beta-G-7, pregnancy-specific glycoprotein 7,
• Gene location: 19q13.31 (42937206: 42924131)     Exons: 6     NC_000019.10
• Gene summary(Entrez): This gene is a member of the pregnancy-specific glycoprotein (PSG) gene family. The PSG genes are a subgroup of the carcinoembryonic antigen (CEA) family of immunoglobulin-like genes, and are found in a gene cluster at 19q13.1-q13.2 telomeric to another c
• OMIM: 605208

Protein Summary

• Protein general information: Q13046  
  • Name: Putative pregnancy specific beta 1 glycoprotein 7 (PS beta G 7) (PSBG 7) (Pregnancy specific glycoprotein 7)
  • Length: 419  
  • Mass: 47027
• Sequence:

  MGPLSAPPCTQHITWKGLLLTASLLNFWNPPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQNLTGYIWYKGQIRDL
  YHYVTSYIVDGQIIKYGPAYSGRETVYSNASLLIQNVTQEDTGSYTLHIIKRGDGTGGVTGRFTFTLYLETPKPS
  ISSSNFNPREATEAVILTCDPETPDASYLWWMNGQSLPMTHSLQLSETNRTLYLFGVTNYTAGPYECEIRNPVSA
  SRSDPVTLNLLPKLPKPYITINNLNPRENKDVSTFTCEPKSENYTYIWWLNGQSLPVSPRVKRRIENRILILPSV
  TRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYHSGQNLYLSCFADSNPPAQYSWTINGKFQLS
  GQKLSIPQITTKHSGLYACSVRNSATGKESSKSVTVRVSDWTLP

• Structural information:
  • Protein Domains: (35..14-)
    (/note="Ig-like-V-type)
    (147..23-)
    1 (/note="Ig-like-C2-type)
    (240..32-)
    2 (/note="Ig-like-C2-type)
    (335..41-)
    3" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598   IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000421986
• Other Databases: GeneCards:  PSG7  Malacards:  PSG7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0007565	female pregnancy	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq