• Gene id: 5673

Gene Summary

• Gene Symbol: PSG5   Gene   UCSC   Ensembl
• Aliases: FL-NCA-3, PSG
• Gene name: pregnancy specific beta-1-glycoprotein 5
• Alternate names: pregnancy-specific beta-1-glycoprotein 5, PS-beta-G-5, PSBG-5, Pregnancy-specific beta-1-glycoprotein-5, fetal liver non-specific cross-reactive antigen 3, pregnancy-specific beta 1 glycoprotein, pregnancy-specific glycoprotein 5,
• Gene location: 19q13.31 (43186535: 43167742)     Exons: 7     NC_000019.10
• Gene summary(Entrez): The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunog
• OMIM: 611821

Protein Summary

• Protein general information: Q15238  
  • Name: Pregnancy specific beta 1 glycoprotein 5 (PS beta G 5) (PSBG 5) (Pregnancy specific glycoprotein 5) (Fetal liver non specific cross reactive antigen 3) (FL NCA 3)
  • Length: 335  
  • Mass: 37713
  • Tissue specificity: Synthesized by syncytiotrophoblast of the placenta.
• Sequence:

  MGPLSAPPCTQHITWKGLLLTASLLNFWNLPITAQVTIEALPPKVSEGKDVLLLVHNLPQNLAGYIWYKGQLMDL
  YHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSYTLHIIKRGDRTRGVTGYFTFNLYLKLPKPY
  ITINNSKPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYECEIRDRDGG
  MRSDPVTLNVLYGPDLPSIYPSFTYYRSGENLYLSCFAESNPPAEYFWTINGKFQQSGQKLSIPQITTKHRGLYT
  CSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI

• Structural information:
  • Protein Domains: (35..14-)
    (/note="Ig-like-V-type)
    (147..23-)
    1 (/note="Ig-like-C2-type)
    (239..31-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598   IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000382334
• Other Databases: GeneCards:  PSG5  Malacards:  PSG5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0007565	female pregnancy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881