• Gene id: 567

Gene Summary

• Gene Symbol: B2M   Gene   UCSC   Ensembl
• Aliases: IMD43
• Gene name: beta-2-microglobulin
• Alternate names: beta-2-microglobulin, beta chain of MHC class I molecules, beta-2-microglobin,
• Gene location: 15q21.1 (44711486: 44718158)     Exons: 4     NC_000015.10
• Gene summary(Entrez): This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fib
• OMIM: 109700

Protein Summary

• Protein general information: P61769  
  • Name: Beta 2 microglobulin [Cleaved into: Beta 2 microglobulin form pI 5.3]
  • Length: 119  
  • Mass: 13,715
• Sequence:

  MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLS
  FSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM

• Structural information:
  • Protein Domains: Ig-like (25-113)
  • Interpro: IPR015707  IPR007110  IPR036179  IPR013783  IPR003006   IPR003597  
  • Prosite: PS50835 PS00290
  • PDB: 1A1M 1A1N 1A1O 1A6Z 1A9B 1A9E 1AGB 1AGC 1AGD 1AGE 1AGF 1AKJ 1AO7 1B0G 1B0R 1BD2 1C16 1CE6 1CG9 1DE4 1DUY 1DUZ 1E27 1E28 1EEY 1EEZ 1EFX 1EXU 1GZP 1GZQ 1HHG 1HHH 1HHI 1HHJ 1HHK 1HLA 1HSA 1HSB 1I1F 1I1Y 1I4F 1I7R 1I7T 1I7U 1IM3 1IM9 1JF1 1JGD 1JGE 1JHT 1JNJ
  • PDBsum: 1A1M 1A1N 1A1O 1A6Z 1A9B 1A9E 1AGB 1AGC 1AGD 1AGE 1AGF 1AKJ 1AO7 1B0G 1B0R 1BD2 1C16 1CE6 1CG9 1DE4 1DUY 1DUZ 1E27 1E28 1EEY 1EEZ 1EFX 1EXU 1GZP 1GZQ 1HHG 1HHH 1HHI 1HHJ 1HHK 1HLA 1HSA 1HSB 1I1F 1I1Y 1I4F 1I7R 1I7T 1I7U 1IM3 1IM9 1JF1 1JGD 1JGE 1JHT 1JNJ
  • DIP: 6055
  • STRING: ENSP00000452780
• Other Databases: GeneCards:  B2M  Malacards:  B2M

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0001895	retina homeostasis	IEP	biological process
GO:0001916	positive regulation of T cell mediated cytotoxicity	IEA	biological process
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0002474	antigen processing and presentation of peptide antigen via MHC class I	TAS	biological process
GO:0002479	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS	biological process
GO:0002480	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent	TAS	biological process
GO:0002481	antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent	IEA	biological process
GO:0002726	positive regulation of T cell cytokine production	IDA	biological process
GO:0003254	regulation of membrane depolarization	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0019885	antigen processing and presentation of endogenous peptide antigen via MHC class I	IGI	biological process
GO:0030670	phagocytic vesicle membrane	TAS	cellular component
GO:0031901	early endosome membrane	TAS	cellular component
GO:0031901	early endosome membrane	TAS	cellular component
GO:0031905	early endosome lumen	TAS	cellular component
GO:0031905	early endosome lumen	TAS	cellular component
GO:0031905	early endosome lumen	TAS	cellular component
GO:0032092	positive regulation of protein binding	IGI	biological process
GO:0033077	T cell differentiation in thymus	IEA	biological process
GO:0042026	protein refolding	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042612	MHC class I protein complex	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0046686	response to cadmium ion	IEA	biological process
GO:0048260	positive regulation of receptor-mediated endocytosis	IGI	biological process
GO:0050690	regulation of defense response to virus by virus	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0055072	iron ion homeostasis	IC	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0071281	cellular response to iron ion	IGI	biological process
GO:1900121	negative regulation of receptor binding	IDA	biological process
GO:1900122	positive regulation of receptor binding	IGI	biological process
GO:1903991	positive regulation of ferrous iron import into cell	IGI	biological process
GO:1904434	positive regulation of ferrous iron binding	IGI	biological process
GO:1904437	positive regulation of transferrin receptor binding	IGI	biological process
GO:1990712	HFE-transferrin receptor complex	IDA	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0001895	retina homeostasis	IEP	biological process
GO:0001916	positive regulation of T cell mediated cytotoxicity	IEA	biological process
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0002237	response to molecule of bacterial origin	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0002474	antigen processing and presentation of peptide antigen via MHC class I	IEA	biological process
GO:0002474	antigen processing and presentation of peptide antigen via MHC class I	TAS	biological process
GO:0002479	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS	biological process
GO:0002480	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent	TAS	biological process
GO:0002481	antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent	IEA	biological process
GO:0002726	positive regulation of T cell cytokine production	IDA	biological process
GO:0003254	regulation of membrane depolarization	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006955	immune response	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0019885	antigen processing and presentation of endogenous peptide antigen via MHC class I	IGI	biological process
GO:0030670	phagocytic vesicle membrane	TAS	cellular component
GO:0031901	early endosome membrane	TAS	cellular component
GO:0031901	early endosome membrane	TAS	cellular component
GO:0031905	early endosome lumen	TAS	cellular component
GO:0031905	early endosome lumen	TAS	cellular component
GO:0031905	early endosome lumen	TAS	cellular component
GO:0032092	positive regulation of protein binding	IGI	biological process
GO:0033077	T cell differentiation in thymus	IEA	biological process
GO:0042026	protein refolding	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042612	MHC class I protein complex	IEA	cellular component
GO:0042612	MHC class I protein complex	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0046686	response to cadmium ion	IEA	biological process
GO:0048260	positive regulation of receptor-mediated endocytosis	IGI	biological process
GO:0050690	regulation of defense response to virus by virus	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0055072	iron ion homeostasis	IEA	biological process
GO:0055072	iron ion homeostasis	IC	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0071281	cellular response to iron ion	IGI	biological process
GO:1900121	negative regulation of receptor binding	IDA	biological process
GO:1900122	positive regulation of receptor binding	IGI	biological process
GO:1903991	positive regulation of ferrous iron import into cell	IGI	biological process
GO:1904434	positive regulation of ferrous iron binding	IGI	biological process
GO:1904437	positive regulation of transferrin receptor binding	IGI	biological process
GO:1990712	HFE-transferrin receptor complex	IDA	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0001895	retina homeostasis	IEP	biological process
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0002474	antigen processing and presentation of peptide antigen via MHC class I	TAS	biological process
GO:0002479	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS	biological process
GO:0002480	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent	TAS	biological process
GO:0002726	positive regulation of T cell cytokine production	IDA	biological process
GO:0003254	regulation of membrane depolarization	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0019885	antigen processing and presentation of endogenous peptide antigen via MHC class I	IGI	biological process
GO:0030670	phagocytic vesicle membrane	TAS	cellular component
GO:0031901	early endosome membrane	TAS	cellular component
GO:0031901	early endosome membrane	TAS	cellular component
GO:0031905	early endosome lumen	TAS	cellular component
GO:0031905	early endosome lumen	TAS	cellular component
GO:0031905	early endosome lumen	TAS	cellular component
GO:0032092	positive regulation of protein binding	IGI	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0048260	positive regulation of receptor-mediated endocytosis	IGI	biological process
GO:0050690	regulation of defense response to virus by virus	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0055072	iron ion homeostasis	IC	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0071281	cellular response to iron ion	IGI	biological process
GO:1900121	negative regulation of receptor binding	IDA	biological process
GO:1900122	positive regulation of receptor binding	IGI	biological process
GO:1903991	positive regulation of ferrous iron import into cell	IGI	biological process
GO:1904434	positive regulation of ferrous iron binding	IGI	biological process
GO:1904437	positive regulation of transferrin receptor binding	IGI	biological process
GO:1990712	HFE-transferrin receptor complex	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04612	Antigen processing and presentation
hsa05166	Human T-cell leukemia virus 1 infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05168	Herpes simplex virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa05169	Epstein-Barr virus infection

Diseases

Associated diseases	References
Cancer	GAD: 18393655
Rheumatoid arthritis	GAD: 18835879
Diabetes	GAD: 9166681
Hypercatabolic hypoproteinemia	KEGG: H01303
Parkinson disease	GAD: 18568448
Chronic renal failure	GAD: 21085059
Male factor infertility	MIK: 1986964
Azoospermia	MIK: 83595
Oligozoospermia	MIK: 1986964
Oligozoospermia	MIK: 1986964
Male factor infertility	MIK: 10526649
Polyzoospermia	MIK: 1986964
Polyzoospermia	MIK: 1986964
Azoospermia	MIK: 1986964
Azoospermia	MIK: 83595
Oligozoospermia	MIK: 1986964
Polyzoospermia	MIK: 1986964
Hypospermatogenesis	MIK: 28361989
Male infertility	MIK: 10526649
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
10526649	Male infertility				Male infertility
1986964	Azoospermia, oligozoospermia, polyzoospermia, Male infertility			171 (50 subjects with normal sperm count; 32 with azoospermia; 49 with oligozoospermia; 10 with polyzoospermia; and 31 vasectomized)	Male infertility	transferrin  beta 2-microglobulin and albumin
83595	Azoospermia				Male infertility
1986964	Azoospermia, Oligozoospermia			171 (50 subjects with normal sperm count; 32 with azoospermia; 49 with oligozoospermia; 10 with polyzoospermia; and 31 vasectomized)	Male infertility	Transferrin beta 2-microglobulin albumin
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray