• Gene id: 5669

Gene Summary

• Gene Symbol: PSG1   Gene   UCSC   Ensembl
• Aliases: B1G1, CD66f, DHFRP2, FL-NCA-1/2, PBG1, PS-beta-C/D, PS-beta-G-1, PSBG-1, PSBG1, PSG95, PSGGA, PSGIIA, SP1
• Gene name: pregnancy specific beta-1-glycoprotein 1
• Alternate names: pregnancy-specific beta-1-glycoprotein 1, CD66 antigen-like family member F, fetal liver non-specific cross-reactive antigen 1/2, pregnancy-specific B-1 glycoprotein, pregnancy-specific beta-1 glycoprotein C/D,
• Gene location: 19q13.2 (42879821: 42866460)     Exons: 7     NC_000019.10
• Gene summary(Entrez): The human placenta is a multihormonal endocrine organ that produces hormones, enzymes, and other molecules that support fetal survival and development. Pregnancy-specific beta-1-glycoprotein (PSBG, PSG) is a major product of the syncytiotrophoblast, reach
• OMIM: 176390

Protein Summary

• Protein general information: P11464  
  • Name: Pregnancy specific beta 1 glycoprotein 1 (PS beta G 1) (PSBG 1) (Pregnancy specific glycoprotein 1) (CD66 antigen like family member F) (Fetal liver non specific cross reactive antigen 1/2) (FL NCA 1/2) (PSG95) (Pregnancy specific beta 1 glycoprotein C/D)
  • Length: 419  
  • Mass: 47,223
• Sequence:

  MGTLSAPPCTQRIKWKGLLLTASLLNFWNLPTTAQVTIEAEPTKVSEGKDVLLLVHNLPQNLTGYIWYKGQMRDL
  YHYITSYVVDGEIIIYGPAYSGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLETPKPS
  ISSSNLNPRETMEAVSLTCDPETPDASYLWWMNGQSLPMTHSLKLSETNRTLFLLGVTKYTAGPYECEIRNPVSA
  SRSDPVTLNLLPKLPKPYITINNLNPRENKDVLNFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSV
  TRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYRSGEVLYLSCSADSNPPAQYSWTINEKFQLP
  GQKLFIRHITTKHSGLYVCSVRNSATGKESSKSMTVEVSDWTVP

• Structural information:
  • Protein Domains: Ig-like (35-144)
    Ig-like (149-234)
    Ig-like (240-327)
    Ig-like (335-410)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598   IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000244296
• Other Databases: GeneCards:  PSG1  Malacards:  PSG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007565	female pregnancy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0007565	female pregnancy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007565	female pregnancy	TAS	biological process

Diseases

Associated diseases	References
Male factor infertility	MIK: 18987160
Male infertility	MIK: 18987160

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
18987160	Male infertility			42 (11 fertile men, 31 infertile men)	Male infertility	PSG1 HLA-E