• Gene id: 56674

Gene Summary

• Gene Symbol: TMEM9B   Gene   UCSC   Ensembl
• Aliases: C11orf15
• Gene name: TMEM9 domain family member B
• Alternate names: transmembrane protein 9B,
• Gene location: 11p15.4 (8965010: 8947200)     Exons: 6     NC_000011.10

Protein Summary

• Protein general information: Q9NQ34  
  • Name: Transmembrane protein 9B
  • Length: 198  
  • Mass: 22531
• Sequence:

  MATLWGGLLRLGSLLSLSCLALSVLLLAQLSDAAKNFEDVRCKCICPPYKENSGHIYNKNISQKDCDCLHVVEPM
  PVRGPDVEAYCLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQ
  PFANAHDVLARSRSRANVLNKVEYAQQRWKLQVQEQRKSVFDRHVVLS

• Structural information:
  • Interpro: IPR008853  
  • STRING: ENSP00000433361
• Other Databases: GeneCards:  TMEM9B  Malacards:  TMEM9B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0031901	early endosome membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881