• Gene id: 56672

Gene Summary

• Gene Symbol: AKIP1   Gene   UCSC   Ensembl
• Aliases: BCA3, C11orf17
• Gene name: A-kinase interacting protein 1
• Alternate names: A-kinase-interacting protein 1, A kinase (PRKA) interacting protein 1, breast cancer associated gene 3, koyt binding protein 1, koyt binding protein 2, koyt binding protein 3, proline-rich protein BCA3,
• Gene location: 11p15.4 (8911116: 8920078)     Exons: 6     NC_000011.10
• Gene summary(Entrez): This gene encodes a nuclear protein that interacts with protein kinase A catalytic subunit, and regulates the effect of the cAMP-dependent protein kinase signaling pathway on the NF-kappa-B activation cascade. Alternatively spliced transcript variants hav
• OMIM: 609191

Protein Summary

• Protein general information: Q9NQ31  
  • Name: A kinase interacting protein 1 (Breast cancer associated gene 3 protein) (PKA interacting protein) (Proline rich protein BCA3)
  • Length: 210  
  • Mass: 23114
  • Tissue specificity: Expressed at high levels in adult heart and at lower levels in brain, testis, ovary and skeletal muscle. Up-regulated in some breast cancer cell lines. Isoform 1 and isoform 3 are expressed in fetal brain. {ECO
• Sequence:

  MDNCLAAAALNGVDRRSLQRSARLALEVLERAKRRAVDWHALERPKGCMGVLAREAPHLEKQPAAGPQRVLPGER
  EERPPTLSASFRTMAEFMDYTSSQCGKYYSSVPEEGGATHVYRYHRGESKLHMCLDIGNGQRKDRKKTSLGPGGS
  YQISEHAPEASQPAENISKDLYIEVYPGTYSVTVGSNDLTKKTHVVAVDSGQSVDLVFPV

• Structural information:
  • Interpro: IPR033214  
  • STRING: ENSP00000310459
• Other Databases: GeneCards:  AKIP1  Malacards:  AKIP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005654	nucleoplasm	IBA	cellular component
GO:1901222	regulation of NIK/NF-kappaB signaling	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034446	substrate adhesion-dependent cell spreading	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)