• Gene id: 56670

Gene Summary

• Gene Symbol: SUCNR1   Gene   UCSC   Ensembl
• Aliases: GPR91
• Gene name: succinate receptor 1
• Alternate names: succinate receptor 1, G-protein coupled receptor 91, P2Y purinoceptor 1,
• Gene location: 3q25.1 (151873642: 151884618)     Exons: 3     NC_000003.12
• Gene summary(Entrez): This gene encodes a G-protein-coupled receptor for succinate, an intermediate molecule of the citric acid cycle. It is involved in the promotion of hematopoietic progenitor cell development, and it has a potential role in renovascular hypertension which h
• OMIM: 616856

Protein Summary

• Protein general information: Q9BXA5  
  • Name: Succinate receptor 1 (G protein coupled receptor 91) (P2Y purinoceptor 1 like)
  • Length: 334  
  • Mass: 38698
  • Tissue specificity: Expressed specifically in kidney. {ECO
• Sequence:

  MLGIMAWNATCKNWLAAEAALEKYYLSIFYGIEFVVGVLGNTIVVYGYIFSLKNWNSSNIYLFNLSVSDLAFLCT
  LPMLIRSYANGNWIYGDVLCISNRYVLHANLYTSILFLTFISIDRYLIIKYPFREHLLQKKEFAILISLAIWVLV
  TLELLPILPLINPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKIALFLKQRNRQVATAL
  PLEKPLNLVIMAVVIFSVLFTPYHVMRNVRIASRLGSWKQYQCTQVVINSFYIVTRPLAFLNSVINPVFYFLLGD
  HFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK

• Structural information:
  • Interpro: IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000355156
• Other Databases: GeneCards:  SUCNR1  Malacards:  SUCNR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0032611	interleukin-1 beta production	IMP	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0002001	renin secretion into blood stream	IEA	biological process
GO:0032611	interleukin-1 beta production	IEA	biological process
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0042593	glucose homeostasis	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IEA	biological process
GO:0050921	positive regulation of chemotaxis	IEA	biological process
GO:0051592	response to calcium ion	IEA	biological process
GO:0002281	macrophage activation involved in immune response	IEA	biological process
GO:0060177	regulation of angiotensin metabolic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04024	cAMP signaling pathway

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R