• Gene id: 56655

Gene Summary

• Gene Symbol: POLE4   Gene   UCSC   Ensembl
• Aliases: YHHQ1, p12
• Gene name: DNA polymerase epsilon 4, accessory subunit
• Alternate names: DNA polymerase epsilon subunit 4, DNA polymerase II subunit 4, DNA polymerase epsilon subunit p12, polymerase (DNA) epsilon 4, accessory subunit, polymerase (DNA-directed), epsilon 4, accessory subunit,
• Gene location: 2p12 (74958642: 74970127)     Exons: 4     NC_000002.12
• Gene summary(Entrez): POLE4 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[su

Protein Summary

• Protein general information: Q9NR33  
  • Name: DNA polymerase epsilon subunit 4 (DNA polymerase II subunit 4) (DNA polymerase epsilon subunit p12)
  • Length: 117  
  • Mass: 12209
• Sequence:

  MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFV
  ETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD

• Structural information:
  • Interpro: IPR003958  IPR009072  
  • STRING: ENSP00000420176
• Other Databases: GeneCards:  POLE4  Malacards:  POLE4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008622	epsilon DNA polymerase complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0008622	epsilon DNA polymerase complex	IDA	cellular component
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003887	DNA-directed DNA polymerase activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006270	DNA replication initiation	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0071897	DNA biosynthetic process	IEA	biological process
GO:0008622	epsilon DNA polymerase complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0008622	epsilon DNA polymerase complex	IDA	cellular component
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003887	DNA-directed DNA polymerase activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006270	DNA replication initiation	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0071897	DNA biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa03420	Nucleotide excision repair
hsa03030	DNA replication
hsa03410	Base excision repair

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881