• Gene id: 56649

Gene Summary

• Gene Symbol: TMPRSS4   Gene   UCSC   Ensembl
• Aliases: CAPH2, MT-SP2, TMPRSS3
• Gene name: transmembrane serine protease 4
• Alternate names: transmembrane protease serine 4, channel-activating protease 2, membrane-type serine protease 2, transmembrane protease, serine 4, transmembrane serine protease 3, type II membrane serine protease,
• Gene location: 11q23.3 (118077011: 118125504)     Exons: 16     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pa
• OMIM: 176395

Protein Summary

• Protein general information: Q9NRS4  
  • Name: Transmembrane protease serine 4 (EC 3.4.21. ) (Channel activating protease 2) (CAPH2) (Membrane type serine protease 2) (MT SP2)
  • Length: 437  
  • Mass: 48246
  • Tissue specificity: High levels in pancreatic, gastric, colorectal and ampullary cancer. Very weak expression in normal gastrointestinal and urogenital tract.
• Sequence:

  MLQDPDSDQPLNSLDVKPLRKPRIPMETFRKVGIPIIIALLSLASIIIVVVLIKVILDKYYFLCGQPLHFIPRKQ
  LCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQMGYSSKPT
  FRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGVEEASVDSWPWQVSIQYD
  KQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPL
  TFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGI
  PEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNVWKAEL

• Structural information:
  • Protein Domains: (61..9-)
    A (/note="LDL-receptor-class)
    (94..20-)
    (/note="SRCR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00196-)
    (205..43-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR036055  IPR002172  IPR009003  IPR001314  IPR001190   IPR017448  IPR036772  IPR001254  IPR018114  IPR033116  
  • Prosite: PS50287 PS50240 PS00134 PS00135
  • CDD: cd00112 cd00190
  • STRING: ENSP00000477949
• Other Databases: GeneCards:  TMPRSS4  Malacards:  TMPRSS4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005044	scavenger receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045967	negative regulation of growth rate	IDA	biological process
GO:0030141	secretory granule	IDA	cellular component
GO:0010468	regulation of gene expression	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030141	secretory granule	IEA	cellular component
GO:0009611	response to wounding	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0006508	proteolysis	NAS	biological process
GO:0004252	serine-type endopeptidase activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05164	Influenza A

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq