• Gene id: 56648

Gene Summary

• Gene Symbol: EIF5A2   Gene   UCSC   Ensembl
• Aliases: EIF-5A2, eIF5AII
• Gene name: eukaryotic translation initiation factor 5A2
• Alternate names: eukaryotic translation initiation factor 5A-2, eIF-5A-2, eukaryotic initiation factor 5A,
• Gene location: 3q26.2 (38374549: 38383823)     Exons: 7     NC_000019.10
• OMIM: 605782

Protein Summary

• Protein general information: Q9GZV4  
  • Name: Eukaryotic translation initiation factor 5A 2 (eIF 5A 2) (eIF 5A2) (Eukaryotic initiation factor 5A isoform 2)
  • Length: 153  
  • Mass: 16793
  • Tissue specificity: Expressed in ovarian and colorectal cancer cell lines (at protein level). Highly expressed in testis. Overexpressed in some cancer cells. {ECO
• Sequence:

  MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPS
  THNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIK
  PCK

• Structural information:
  • Interpro: IPR001884  IPR012340  IPR014722  IPR019769  IPR020189   IPR008991  
  • Prosite: PS00302
  • STRING: ENSP00000295822
• Other Databases: GeneCards:  EIF5A2  Malacards:  EIF5A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045901	positive regulation of translational elongation	IBA	biological process
GO:0003746	translation elongation factor activity	IBA	molecular function
GO:0003746	translation elongation factor activity	IEA	molecular function
GO:0043022	ribosome binding	IEA	molecular function
GO:0045901	positive regulation of translational elongation	IEA	biological process
GO:0045905	positive regulation of translational termination	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0003746	translation elongation factor activity	IEA	molecular function
GO:0005643	nuclear pore	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006414	translational elongation	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0051028	mRNA transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005643	nuclear pore	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0010509	polyamine homeostasis	NAS	biological process
GO:0008284	positive regulation of cell population proliferation	IGI	biological process
GO:0007283	spermatogenesis	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R