• Gene id: 56647

Gene Summary

• Gene Symbol: BCCIP   Gene   UCSC   Ensembl
• Aliases: TOK-1, TOK1
• Gene name: BRCA2 and CDKN1A interacting protein
• Alternate names: BRCA2 and CDKN1A-interacting protein, BCCIPalpha, BCCIPbeta, BRCA2 and Cip1/p21 interacting protein, TOK-1alpha, TOK-1beta, cdk inhibitor p21 binding protein, p21- and CDK-associated protein 1, protein TOK-1,
• Gene location: 10q26.2 (125823545: 125853694)     Exons: 9     NC_000010.11
• Gene summary(Entrez): This gene product was isolated on the basis of its interaction with BRCA2 and p21 proteins. It is an evolutionarily conserved nuclear protein with multiple interacting domains. The N-terminal half shares moderate homology with regions of calmodulin and M-
• OMIM: 611883

Protein Summary

• Protein general information: Q9P287  
  • Name: BRCA2 and CDKN1A interacting protein (P21 and CDK associated protein 1) (Protein TOK 1)
  • Length: 314  
  • Mass: 35979
  • Tissue specificity: Expressed at high levels in testis and skeletal muscle and at lower levels in brain, heart, kidney, liver, lung, ovary, pancreas, placenta, and spleen. {ECO
• Sequence:

  MASRSKRRAVESGVPQPPDPPVQRDEEEEKEVENEDEDDDDSDKEKDEEDEVIDEEVNIEFEAYSLSDNDYDGIK
  KLLQQLFLKAPVNTAELTDLLIQQNHIGSVIKQTDVSEDSNDDMDEDEVFGFISLLNLTERKGTQCVEQIQELVL
  RFCEKNCEKSMVEQLDKFLNDTTKPVGLLLSERFINVPPQIALPMYQQLQKELAGAHRTNKPCGKCYFYLLISKT
  FVEAGKNNSKKKPSNKKKAALMFANAEEEFFYEKAILKFNYSVQEESDTCLGGKWSFDDVPMTPLRTVMLIPGDK
  MNEIMDKLKEYLSV

• Structural information:
  • Interpro: IPR025602  
  • STRING: ENSP00000357748
• Other Databases: GeneCards:  BCCIP  Malacards:  BCCIP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097431	mitotic spindle pole	IBA	cellular component
GO:0090307	mitotic spindle assembly	IBA	biological process
GO:0034453	microtubule anchoring	IBA	biological process
GO:0015631	tubulin binding	IBA	molecular function
GO:0007052	mitotic spindle organization	IBA	biological process
GO:0005813	centrosome	IBA	cellular component
GO:0000132	establishment of mitotic spindle orientation	IBA	biological process
GO:0019207	kinase regulator activity	IBA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IBA	biological process
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	IBA	biological process
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:0090307	mitotic spindle assembly	IMP	biological process
GO:0007052	mitotic spindle organization	IMP	biological process
GO:0034453	microtubule anchoring	IMP	biological process
GO:0000226	microtubule cytoskeleton organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0019908	nuclear cyclin-dependent protein kinase holoenzyme complex	IDA	cellular component
GO:0019207	kinase regulator activity	IDA	molecular function
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005813	centrosome	IEA	cellular component
GO:0007052	mitotic spindle organization	IEA	biological process
GO:0034453	microtubule anchoring	IEA	biological process
GO:0097431	mitotic spindle pole	IEA	cellular component
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0000922	spindle pole	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0061101	neuroendocrine cell differentiation	IDA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881