• Gene id: 56605

Gene Summary

• Gene Symbol: ERO1B   Gene   UCSC   Ensembl
• Aliases: ERO1LB, Ero1beta
• Gene name: endoplasmic reticulum oxidoreductase 1 beta
• Alternate names: ERO1-like protein beta, ERO1-L-beta, ERO1-like beta, endoplasmic oxidoreductin-1-like protein B, endoplasmic reticulum oxidoreductase beta, endoplasmic reticulum oxidoreductin-1-like protein B, oxidoreductin-1-L-beta,
• Gene location: 1q42.3 (236281982: 236213063)     Exons: 17     NC_000001.11
• OMIM: 615437

Protein Summary

• Protein general information: Q86YB8  
  • Name: ERO1 like protein beta (ERO1 L beta) (EC 1.8.4. ) (Endoplasmic reticulum oxidoreductase beta) (Endoplasmic reticulum oxidoreductin 1 like protein B) (Oxidoreductin 1 L beta)
  • Length: 467  
  • Mass: 53543
  • Tissue specificity: Highly expressed in the digestive tract, including the duodenum and lower digestive tract. In the stomach, highly expressed in enzyme-producing chief cells (at protein level). In the pancreas, expressed in islets of Langerhans and, at
• Sequence:

  MSQGVRRAGAGQGVAAAVQLLVTLSFLRSVVEAQVTGVLDDCLCDIDSIDNFNTYKIFPKIKKLQERDYFRYYKV
  NLKRPCPFWAEDGHCSIKDCHVEPCPESKIPVGIKAGHSNKYLKMANNTKELEDCEQANKLGAINSTLSNQSKEA
  FIDWARYDDSRDHFCELDDERSPAAQYVDLLLNPERYTGYKGTSAWRVWNSIYEENCFKPRSVYRPLNPLAPSRG
  EDDGESFYTWLEGLCLEKRVFYKLISGLHASINLHLCANYLLEETWGKPSWGPNIKEFKHRFDPVETKGEGPRRL
  KNLYFLYLIELRALSKVAPYFERSIVDLYTGNAEEDADTKTLLLNIFQDTKSFPMHFDEKSMFAGDKKGAKSLKE
  EFRLHFKNISRIMDCVGCDKCRLWGKLQTQGLGTALKILFSEKEIQKLPENSPSKGFQLTRQEIVALLNAFGRLS
  TSIRDLQNFKVLLQHSR

• Structural information:
  • Interpro: IPR007266  IPR037192  
  • STRING: ENSP00000346635
• Other Databases: GeneCards:  ERO1B  Malacards:  ERO1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0015035	protein disulfide oxidoreductase activity	IBA	molecular function
GO:0003756	protein disulfide isomerase activity	IBA	molecular function
GO:0034975	protein folding in endoplasmic reticulum	IBA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016671	oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0003756	protein disulfide isomerase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0042593	glucose homeostasis	IEA	biological process
GO:0030070	insulin processing	IEA	biological process
GO:0022417	protein maturation by protein folding	IEA	biological process
GO:0018401	peptidyl-proline hydroxylation to 4-hydroxy-L-proline	IEA	biological process
GO:0015035	protein disulfide oxidoreductase activity	IEA	molecular function
GO:0045454	cell redox homeostasis	IEA	biological process
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	NAS	molecular function
GO:0051082	unfolded protein binding	NAS	molecular function
GO:0006457	protein folding	TAS	biological process
GO:0005783	endoplasmic reticulum	TAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R