• Gene id: 5655

Gene Summary

• Gene Symbol: KLK10   Gene   UCSC   Ensembl
• Aliases: NES1, PRSSL1
• Gene name: kallikrein related peptidase 10
• Alternate names: kallikrein-10, breast normal epithelial cell associated serine protease, kallikrein 10 protein 1, kallikrein 10 protein 12, kallikrein 10 protein 13, kallikrein 10 protein 2, kallikrein 10 protein 3, kallikrein 10 protein 4, kallikrein 10 protein 5, kallikrein 10 ,
• Gene location: 19q13.41 (51020174: 51012738)     Exons: 9     NC_000019.10
• Gene summary(Entrez): Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one

Protein Summary

• Protein general information: O43240  
  • Name: Kallikrein 10 (EC 3.4.21. ) (Normal epithelial cell specific 1) (Protease serine like 1)
  • Length: 276  
  • Mass: 30170
  • Tissue specificity: Expressed in breast, ovary and prostate.
• Sequence:

  MRAPHLHLSAASGARALAKLLPLLMAQLWAAEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVL
  VDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLG
  PRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPC
  QSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN

• Structural information:
  • Protein Domains: (47..27-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR009003  IPR001314  IPR001254  IPR018114  
  • Prosite: PS50240 PS00134
  • CDD: cd00190
  • PDB: 5LPE 5LPF
  • PDBsum: 5LPE 5LPF
  • STRING: ENSP00000311746
• Other Databases: GeneCards:  KLK10  Malacards:  KLK10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030141	secretory granule	IBA	cellular component
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Ductal carcinoma in situ	PMID:12788170
Prostate cancer	PMID:11920956
Ovarian cancer	PMID:18766180
Uterine cancer	PMID:16647913
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq