• Gene id: 56548

Gene Summary

• Gene Symbol: CHST7   Gene   UCSC   Ensembl
• Aliases: C6ST-2, GST-5
• Gene name: carbohydrate sulfotransferase 7
• Alternate names: carbohydrate sulfotransferase 7, N-acetylglucosamine 6-O-sulfotransferase 4, carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 7, chondroitin 6-sulfotransferase-2, galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 5, glcNAc6ST-4, gn6s,
• Gene location: Xp11.3 (42809444: 42867285)     Exons: 3     NC_000003.12
• Gene summary(Entrez): This gene is a member of the Gal/GalNAc/GlcNAc (galactose/N-acetylgalactosamine/N-acetylglucosamine) 6-O-sulfotransferase (GST) family. Members of this family encode enzymes that catalyze the specific addition of sulfate groups to distinct hydroxyl and am
• OMIM: 0

Protein Summary

• Protein general information: Q9NS84  
  • Name: Carbohydrate sulfotransferase 7 (EC 2.8.2. ) (EC 2.8.2.17) (Chondroitin 6 sulfotransferase 2) (C6ST 2) (Galactose/N acetylglucosamine/N acetylglucosamine 6 O sulfotransferase 5) (GST 5) (N acetylglucosamine 6 O sulfotransferase 4) (GlcNAc6ST 4) (Gn6st 4)
  • Length: 486  
  • Mass: 54266
  • Tissue specificity: Widely expressed. Highly expressed in heart, spleen, liver and ovary. Expressed at lower level in brain, placenta, thyroid, spinal cord and peripheral blood leukocytes. Not expressed in adult skin. {ECO
• Sequence:

  MKGRRRRRREYCKFALLLVLYTLVLLLVPSVLDGGRDGDKGAEHCPGLQRSLGVWSLEAAAAGEREQGAEARAAE
  EGGANQSPRFPSNLSGAVGEAVSREKQHIYVHATWRTGSSFLGELFNQHPDVFYLYEPMWHLWQALYPGDAESLQ
  GALRDMLRSLFRCDFSVLRLYAPPGDPAARAPDTANLTTAALFRWRTNKVICSPPLCPGAPRARAEVGLVEDTAC
  ERSCPPVAIRALEAECRKYPVVVIKDVRLLDLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQ
  VLRTRQRGDRFHRVLLAHGVGARPGGQSRALPAAPRADFFLTGALEVICEAWLRDLLFARGAPAWLRRRYLRLRY
  EDLVRQPRAQLRRLLRFSGLRALAALDAFALNMTRGAAYGADRPFHLSARDAREAVHAWRERLSREQVRQVEAAC
  APAMRLLAYPRSGEEGDAEQPREGETPLEMDADGAT

• Structural information:
  • Interpro: IPR016469  IPR027417  IPR000863  
  • STRING: ENSP00000276055
• Other Databases: GeneCards:  CHST7  Malacards:  CHST7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008459	chondroitin 6-sulfotransferase activity	IBA	molecular function
GO:0006044	N-acetylglucosamine metabolic process	IBA	biological process
GO:0005802	trans-Golgi network	IBA	cellular component
GO:0030206	chondroitin sulfate biosynthetic process	IBA	biological process
GO:0006790	sulfur compound metabolic process	IBA	biological process
GO:0001517	N-acetylglucosamine 6-O-sulfotransferase activity	IBA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008459	chondroitin 6-sulfotransferase activity	IEA	molecular function
GO:0030206	chondroitin sulfate biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0008459	chondroitin 6-sulfotransferase activity	IDA	molecular function
GO:0030206	chondroitin sulfate biosynthetic process	IDA	biological process
GO:0006790	sulfur compound metabolic process	IDA	biological process
GO:0006044	N-acetylglucosamine metabolic process	IDA	biological process
GO:0001517	N-acetylglucosamine 6-O-sulfotransferase activity	IDA	molecular function
GO:0016021	integral component of membrane	TAS	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0005976	polysaccharide metabolic process	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa00532	Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R