• Gene id: 5653

Gene Summary

• Gene Symbol: KLK6   Gene   UCSC   Ensembl
• Aliases: Bssp, Klk7, PRSS18, PRSS9, SP59, hK6
• Gene name: kallikrein related peptidase 6
• Alternate names: kallikrein-6, kallikrein 6, neurosin, protease M, serine protease 18, serine protease 9, zyme,
• Gene location: 19q13.41 (50969597: 50958630)     Exons: 7     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the kallikrein subfamily of the peptidase S1 family of serine proteases. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. T
• OMIM: 608421

Protein Summary

• Protein general information: Q92876  
  • Name: Kallikrein 6 (EC 3.4.21. ) (Neurosin) (Protease M) (SP59) (Serine protease 18) (Serine protease 9) (Zyme)
  • Length: 244  
  • Mass: 26856
  • Tissue specificity: In fluids, highest levels found in milk of lactating women followed by cerebrospinal fluid, nipple aspirate fluid and breast cyst fluid. Also found in serum, seminal plasma and some amniotic fluids and breast tumor cytosolic extracts.
• Sequence:

  MKKLMVVLSLIAAAWAEEQNKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQVFLGKH
  NLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSCHILGWGKTADGD
  FPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPG
  VYTNVCRYTNWIQKTIQAK

• Structural information:
  • Protein Domains: (22..24-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR009003  IPR001314  IPR001254  IPR018114  IPR033116  
  • Prosite: PS50240 PS00134 PS00135
  • CDD: cd00190
  • PDB: 1GVL 1L2E 1LO6 3VFE 4D8N 5NX1 5NX3 6QFF 6QFG 6QFH 6QH9 6QHA 6QHB 6QHC 6SKB 6SKC 6SKD
  • PDBsum: 1GVL 1L2E 1LO6 3VFE 4D8N 5NX1 5NX3 6QFF 6QFG 6QFH 6QH9 6QHA 6QHB 6QHC 6SKB 6SKC 6SKD
  • STRING: ENSP00000366047
• Other Databases: GeneCards:  KLK6  Malacards:  KLK6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030141	secretory granule	IBA	cellular component
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0010975	regulation of neuron projection development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0045745	positive regulation of G protein-coupled receptor signaling pathway	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0045595	regulation of cell differentiation	NAS	biological process
GO:0042445	hormone metabolic process	NAS	biological process
GO:0030574	collagen catabolic process	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042982	amyloid precursor protein metabolic process	NAS	biological process
GO:0004252	serine-type endopeptidase activity	NAS	molecular function
GO:0042246	tissue regeneration	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	HDA	cellular component
GO:0042552	myelination	NAS	biological process
GO:0016540	protein autoprocessing	NAS	biological process
GO:0009611	response to wounding	NAS	biological process
GO:0007417	central nervous system development	NAS	biological process

Diseases

Associated diseases	References
Prostate cancer	PMID:12970725
Alzheimer's disease	PMID:12480753
Alzheimer's disease	PMID:12074831
Lewy body dementia	PMID:12928483
Parkinson's disease	PMID:12928483
Ovarian cancer	PMID:17303231
Demyelinating disease	PMID:12023317
Breast carcinoma	PMID:18992199
renal cell carcinoma	PMID:16340244
Multiple system atrophy	PMID:12928483
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq