• Gene id: 56477

Gene Summary

• Gene Symbol: CCL28   Gene   UCSC   Ensembl
• Aliases: CCK1, MEC, SCYA28
• Gene name: C-C motif chemokine ligand 28
• Alternate names: C-C motif chemokine 28, CC chemokine CCL28, chemokine (C-C motif) ligand 28 splice variant chi, mucosae-associated epithelial chemokine, small inducible cytokine A28, small inducible cytokine subfamily A (Cys-Cys), member 28,
• Gene location: 5p12 (43412390: 43356971)     Exons: 8     NC_000005.10
• Gene summary(Entrez): This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cy
• OMIM: 605178

Protein Summary

• Protein general information: Q9NRJ3  
  • Name: C C motif chemokine 28 (Mucosae associated epithelial chemokine) (MEC) (Protein CCK1) (Small inducible cytokine A28)
  • Length: 127  
  • Mass: 14280
  • Tissue specificity: Preferentially expressed by epithelial cells of diverse tissues including normal and pathological colon, salivary gland, mammary gland, trachea and rectum. Also found in prostate, spleen, thyroid, psoriasis skin and in lower levels in
• Sequence:

  MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVS
  PHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY

• Structural information:
  • Interpro: IPR000827  IPR001811  IPR036048  
  • Prosite: PS00472
  • PDB: 6CWS
  • PDBsum: 6CWS
  • DIP: 57392
  • STRING: ENSP00000354416
• Other Databases: GeneCards:  CCL28  Malacards:  CCL28

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001954	positive regulation of cell-matrix adhesion	IBA	biological process
GO:0005576	extracellular region	IBA	cellular component
GO:0008009	chemokine activity	IBA	molecular function
GO:0060326	cell chemotaxis	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008009	chemokine activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007584	response to nutrient	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008009	chemokine activity	IDA	molecular function
GO:0001954	positive regulation of cell-matrix adhesion	IDA	biological process
GO:0060326	cell chemotaxis	IDA	biological process
GO:1903237	negative regulation of leukocyte tethering or rolling	IDA	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0008009	chemokine activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04672	Intestinal immune network for IgA production

Diseases

Associated diseases	References
Atopic dermatitis	PMID:20161852
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881