• Gene id: 56474

Gene Summary

• Gene Symbol: CTPS2   Gene   UCSC   Ensembl
• Gene name: CTP synthase 2
• Alternate names: CTP synthase 2, CTP synthase II, CTP synthetase type 2, UTP-ammonia ligase 2, cytidine 5'-triphosphate synthetase 2,
• Gene location: Xp22.2 (16712916: 16587998)     Exons: 24     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene catalyzes the formation of CTP from UTP with the concomitant deamination of glutamine to glutamate. This protein is the rate-limiting enzyme in the synthesis of cytosine nucleotides, which play an important role in various

Protein Summary

• Protein general information: Q9NRF8  
  • Name: CTP synthase 2 (EC 6.3.4.2) (CTP synthetase 2) (UTP ammonia ligase 2)
  • Length: 586  
  • Mass: 65678
• Sequence:

  MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYE
  RFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEPQICVIELGGT
  IGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMA
  VKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICS
  IALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEKITETEDPVKFHEAWQKLCKADGILVPGGFGI
  RGTLGKLQAISWARTKKIPFLGVCLGMQLAVIEFARNCLNLKDADSTEFRPNAPVPLVIDMPEHNPGNLGGTMRL
  GIRRTVFKTENSILRKLYGDVPFIEERHRHRFEVNPNLIKQFEQNDLSFVGQDVDGDRMEIIELANHPYFVGVQF
  HPEFSSRPMKPSPPYLGLLLAATGNLNAYLQQGCKLSSSDRYSDASDDSFSEPRIAELEIS

• Structural information:
  • Protein Domains: (300..55-)
    type-1 (/note="Glutamine-amidotransferase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00605"-)
  • Interpro: IPR029062  IPR004468  IPR017456  IPR017926  IPR033828   IPR027417  
  • Prosite: PS51273
  • CDD: cd01746
  • PDB: 2V4U 2VKT 3IHL 6PK4 6PK7
  • PDBsum: 2V4U 2VKT 3IHL 6PK4 6PK7
  • STRING: ENSP00000401264
• Other Databases: GeneCards:  CTPS2  Malacards:  CTPS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003883	CTP synthase activity	IBA	molecular function
GO:0006241	CTP biosynthetic process	IBA	biological process
GO:0019856	pyrimidine nucleobase biosynthetic process	IBA	biological process
GO:0097268	cytoophidium	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0042802	identical protein binding	IBA	molecular function
GO:0003883	CTP synthase activity	IEA	molecular function
GO:0006241	CTP biosynthetic process	IEA	biological process
GO:0006221	pyrimidine nucleotide biosynthetic process	IEA	biological process
GO:0016874	ligase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006221	pyrimidine nucleotide biosynthetic process	IEA	biological process
GO:0006541	glutamine metabolic process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003883	CTP synthase activity	TAS	molecular function
GO:0006220	pyrimidine nucleotide metabolic process	TAS	biological process
GO:0003883	CTP synthase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0015949	nucleobase-containing small molecule interconversion	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0044210	'de novo' CTP biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00240	Pyrimidine metabolism

Diseases

Associated diseases	References
colorectal cancer	PMID:21378502
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray