• Gene id: 5646

Gene Summary

• Gene Symbol: PRSS3   Gene   UCSC   Ensembl
• Aliases: MTG, PRSS4, T9, TRY3, TRY4
• Gene name: serine protease 3
• Alternate names: trypsin-3, brain trypsinogen, mesotrypsin, mesotrypsinogen, pancreatic trypsinogen III, protease, serine 3, protease, serine, 4 (trypsin 4, brain), trypsin III, trypsin IV, trypsinogen 4, trypsinogen 5, trypsinogen IV,
• Gene location: 9p13.3 (33750465: 33799230)     Exons: 9     NC_000009.12
• Gene summary(Entrez): This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is expressed in the brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involving the carboxyl group o
• OMIM: 613578

Protein Summary

• Protein general information: P35030  
  • Name: Trypsin 3 (EC 3.4.21.4) (Brain trypsinogen) (Mesotrypsin) (Mesotrypsinogen) (Serine protease 3) (Serine protease 4) (Trypsin III) (Trypsin IV)
  • Length: 304  
  • Mass: 32529
  • Tissue specificity: Detected in pancreas and pancreatic fluid (at protein level) (PubMed
• Sequence:

  MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGLELHPLLGGRTWRAARDADGCEALGTVAVPF
  DDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKI
  IRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQ
  AECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTI
  AANS

• Structural information:
  • Protein Domains: (81..30-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR009003  IPR001314  IPR001254  IPR018114  
  • Prosite: PS50240 PS00134
  • CDD: cd00190
  • PDB: 1H4W 2R9P 3L33 3L3T 3P92 3P95 4DG4 4U30 4U32 5C67 5JBT 5TP0 6BX8 6GFI
  • PDBsum: 1H4W 2R9P 3L33 3L3T 3P92 3P95 4DG4 4U30 4U32 5C67 5JBT 5TP0 6BX8 6GFI
  • STRING: ENSP00000354280
• Other Databases: GeneCards:  PRSS3  Malacards:  PRSS3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004252	serine-type endopeptidase activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0006508	proteolysis	IBA	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0007586	digestion	IEA	biological process
GO:0007586	digestion	TAS	biological process
GO:0006508	proteolysis	TAS	biological process
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904724	tertiary granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0009235	cobalamin metabolic process	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005509	calcium ion binding	IDA	molecular function
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0006508	proteolysis	IDA	biological process
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0031638	zymogen activation	IDA	biological process
GO:0043542	endothelial cell migration	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006508	proteolysis	NAS	biological process
GO:0007586	digestion	TAS	biological process
GO:0007586	digestion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa05164	Influenza A
hsa04974	Protein digestion and absorption
hsa04972	Pancreatic secretion

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray