• Gene id: 56341

Gene Summary

• Gene Symbol: PRMT8   Gene   UCSC   Ensembl
• Aliases: HRMT1L3, HRMT1L4
• Gene name: protein arginine methyltransferase 8
• Alternate names: protein arginine N-methyltransferase 8, HMT1 hnRNP methyltransferase-like 3, arginine methyltransferase 8, heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4, protein arginine N-methyltransferase 4,
• Gene location: 12p13.32 (3381348: 3593972)     Exons: 23     NC_000012.12
• Gene summary(Entrez): Arginine methylation is a widespread posttranslational modification mediated by arginine methyltransferases, such as PRMT8. Arginine methylation is involved in a number of cellular processes, including DNA repair, RNA transcription, signal transduction, p
• OMIM: 610086

Protein Summary

• Protein general information: Q9NR22  
  • Name: Protein arginine N methyltransferase 8 (EC 2.1.1.319) (EC 2.1.1.321) (Heterogeneous nuclear ribonucleoprotein methyltransferase like protein 4)
  • Length: 394  
  • Mass: 45291
  • Tissue specificity: Brain-specific. {ECO
• Sequence:

  MGMKHSSRCLLLRRKMAENAAESTEVNSPPSQPPQPVVPAKPVQCVHHVSTQPSCPGRGKMSKLLNPEEMTSRDY
  YFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSE
  KIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVA
  IEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQR
  NDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVD
  LDFKGQLCETSVSNDYKMR

• Structural information:
  • Protein Domains: (73..39-)
    PRMT-type (/note="SAM-dependent-MTase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01015"-)
  • Interpro: IPR025799  IPR029063  
  • Prosite: PS51678
  • PDB: 4X41 5DST
  • PDBsum: 4X41 5DST
  • STRING: ENSP00000372067
• Other Databases: GeneCards:  PRMT8  Malacards:  PRMT8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008469	histone-arginine N-methyltransferase activity	IDA	molecular function
GO:0035241	protein-arginine omega-N monomethyltransferase activity	IDA	molecular function
GO:0008757	S-adenosylmethionine-dependent methyltransferase activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0019899	enzyme binding	IDA	molecular function
GO:0005634	nucleus	IDA	NOT|cellular component
GO:0016571	histone methylation	IDA	biological process
GO:0019919	peptidyl-arginine methylation, to asymmetrical-dimethyl arginine	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043393	regulation of protein binding	TAS	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0018216	peptidyl-arginine methylation	IDA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0019919	peptidyl-arginine methylation, to asymmetrical-dimethyl arginine	IDA	biological process
GO:0006479	protein methylation	IDA	biological process
GO:0016571	histone methylation	IDA	biological process
GO:0035241	protein-arginine omega-N monomethyltransferase activity	IDA	molecular function
GO:1904047	S-adenosyl-L-methionine binding	IDA	molecular function
GO:0035241	protein-arginine omega-N monomethyltransferase activity	IDA	molecular function
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	IDA	molecular function
GO:0098753	anchored component of the cytoplasmic side of the plasma membrane	IDA	cellular component
GO:0042802	identical protein binding	IDA	molecular function
GO:0051260	protein homooligomerization	IDA	biological process
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	IDA	molecular function
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	IDA	molecular function
GO:0018216	peptidyl-arginine methylation	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0006479	protein methylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	IEA	molecular function
GO:0018216	peptidyl-arginine methylation	IEA	biological process
GO:0032259	methylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	IEA	molecular function
GO:0035241	protein-arginine omega-N monomethyltransferase activity	IEA	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0034969	histone arginine methylation	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray