• Gene id: 56301

Gene Summary

• Gene Symbol: SLC7A10   Gene   UCSC   Ensembl
• Aliases: ASC1, HASC-1, asc-1
• Gene name: solute carrier family 7 member 10
• Alternate names: asc-type amino acid transporter 1, solute carrier family 7 (neutral amino acid transporter light chain, asc system), member 10, solute carrier family 7, (cationic amino acid transporter, y+ system) member 10, solute carrier family 7, (neutral amino acid tran,
• Gene location: 19q13.11 (33225849: 33208663)     Exons: 11     NC_000019.10
• Gene summary(Entrez): SLC7A10, in association with 4F2HC (SLC3A2; MIM 158070), mediates high-affinity transport of D-serine and several other neutral amino acids (Nakauchi et al., 2000 [PubMed 10863037]).[supplied by OMIM, Mar 2008]
• OMIM: 613037

Protein Summary

• Protein general information: Q9NS82  
  • Name: Asc type amino acid transporter 1 (Asc 1) (Solute carrier family 7 member 10)
  • Length: 523  
  • Mass: 56798
  • Tissue specificity: Expressed in brain, heart, kidney, liver, lung, pancreas, placenta, and skeletal muscle. {ECO
• Sequence:

  MAGHTQQPSGRGNPRPAPSPSPVPGTVPGASERVALKKEIGLLSACTIIIGNIIGSGIFISPKGVLEHSGSVGLA
  LFVWVLGGGVTALGSLCYAELGVAIPKSGGDYAYVTEIFGGLAGFLLLWSAVLIMYPTSLAVISMTFSNYVLQPV
  FPNCIPPTTASRVLSMACLMLLTWVNSSSVRWATRIQDMFTGGKLLALSLIIGVGLLQIFQGHFEELRPSNAFAF
  WMTPSVGHLALAFLQGSFAFSGWNFLNYVTEEMVDARKNLPRAIFISIPLVTFVYTFTNIAYFTAMSPQELLSSN
  AVAVTFGEKLLGYFSWVMPVSVALSTFGGINGYLFTYSRLCFSGAREGHLPSLLAMIHVRHCTPIPALLVCCGAT
  AVIMLVGDTYTLINYVSFINYLCYGVTILGLLLLRWRRPALHRPIKVNLLIPVAYLVFWAFLLVFSFISEPMVCG
  VGVIIILTGVPIFFLGVFWRSKPKCVHRLTESMTHWGQELCFVVYPQDAPEEEENGPCPPSLLPATDKPSKPQ

• Structural information:
  • Interpro: IPR002293  
  • STRING: ENSP00000253188
• Other Databases: GeneCards:  SLC7A10  Malacards:  SLC7A10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015179	L-amino acid transmembrane transporter activity	IBA	molecular function
GO:0015804	neutral amino acid transport	IBA	biological process
GO:0015175	neutral amino acid transmembrane transporter activity	IBA	molecular function
GO:0042941	D-alanine transport	IBA	biological process
GO:0042942	D-serine transport	IBA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0006865	amino acid transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015194	L-serine transmembrane transporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0006865	amino acid transport	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006865	amino acid transport	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0015804	neutral amino acid transport	IEA	biological process
GO:0042942	D-serine transport	IEA	biological process
GO:0042941	D-alanine transport	IEA	biological process
GO:0015175	neutral amino acid transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:1902475	L-alpha-amino acid transmembrane transport	IEA	biological process
GO:0015825	L-serine transport	IEA	biological process
GO:0015804	neutral amino acid transport	IDA	biological process
GO:0015175	neutral amino acid transmembrane transporter activity	IDA	molecular function
GO:0005887	integral component of plasma membrane	NAS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq