• Gene id: 56300

Gene Summary

• Gene Symbol: IL36G   Gene   UCSC   Ensembl
• Aliases: IL-1F9, IL-1H1, IL-1RP2, IL1E, IL1F9, IL1H1, IL1RP2
• Gene name: interleukin 36 gamma
• Alternate names: interleukin-36 gamma, IL-1 related protein 2, IL-1-epsilon, interleukin 1-related protein 2, interleukin-1 epsilon, interleukin-1 family member 9, interleukin-1 homolog 1,
• Gene location: 2q14.1 (112978005: 112985657)     Exons: 5     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 de
• OMIM: 605420

Protein Summary

• Protein general information: Q9NZH8  
  • Name: Interleukin 36 gamma (IL 1 related protein 2) (IL 1RP2) (Interleukin 1 epsilon) (IL 1 epsilon) (Interleukin 1 family member 9) (IL 1F9) (Interleukin 1 homolog 1) (IL 1H1)
  • Length: 169  
  • Mass: 18721
  • Tissue specificity: Highly expressed in tissues containing epithelial cells
• Sequence:

  MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPI
  YLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPII
  LTSELGKSYNTAFELNIND

• Structural information:
  • Interpro: IPR000975  IPR003297  IPR008996  
  • PDB: 4IZE 4P0J 4P0K 4P0L 6P9E
  • PDBsum: 4IZE 4P0J 4P0K 4P0L 6P9E
  • STRING: ENSP00000259205
• Other Databases: GeneCards:  IL36G  Malacards:  IL36G

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006954	inflammatory response	IBA	biological process
GO:0002437	inflammatory response to antigenic stimulus	IBA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0010628	positive regulation of gene expression	IBA	biological process
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0071222	cellular response to lipopolysaccharide	IBA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005149	interleukin-1 receptor binding	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006954	inflammatory response	IBA	biological process
GO:0002437	inflammatory response to antigenic stimulus	IBA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0010628	positive regulation of gene expression	IBA	biological process
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0071222	cellular response to lipopolysaccharide	IBA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005149	interleukin-1 receptor binding	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R