• Gene id: 563

Gene Summary

• Gene Symbol: AZGP1   Gene   UCSC   Ensembl
• Aliases: ZA2G, ZAG
• Gene name: alpha-2-glycoprotein 1, zinc-binding
• Alternate names: zinc-alpha-2-glycoprotein, Alpha-2-glycoprotein, zinc, Zn-alpha2-glycoprotein, testicular tissue protein Li 227, zn-alpha-2-GP, zn-alpha-2-glycoprotein,
• Gene location: 7q22.1 (99976111: 99966726)     Exons: 4     NC_000007.14
• OMIM: 194460

Protein Summary

• Protein general information: P25311  
  • Name: Zinc alpha 2 glycoprotein (Zn alpha 2 GP) (Zn alpha 2 glycoprotein)
  • Length: 298  
  • Mass: 34,259
• Sequence:

  MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFRYNSKDRKSQPMGLWR
  QVEGMEDWKQDSQLQKAREDIFMETLKDIVEYYNDSNGSHVLQGRFGCEIENNRSSGAFWKYYYDGKDYIEFNKE
  IPAWVPFDPAAQITKQKWEAEPVYVQRAKAYLEEECPATLRKYLKYSKNILDRQDPPSVVVTSHQAPGEKKKLKC
  LAYDFYPGKIDVHWTRAGEVQEPELRGDVLHNGNGTYQSWVVVAVPPQDTAPYSCHVQHSSLAQPLVVPWEAS

• Structural information:
  • Protein Domains: Ig-like (207-292)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003006  IPR003597   IPR011161  IPR037055  IPR011162  IPR001039  
  • Prosite: PS50835 PS00290
  • PDB: 1T7V 1T7W 1T7X 1T7Y 1T7Z 1T80 1ZAG 3ES6
  • PDBsum: 1T7V 1T7W 1T7X 1T7Y 1T7Z 1T80 1ZAG 3ES6
  • STRING: ENSP00000292401
• Other Databases: GeneCards:  AZGP1  Malacards:  AZGP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0001895	retina homeostasis	IEP	biological process
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0002474	antigen processing and presentation of peptide antigen via MHC class I	IEA	biological process
GO:0003823	antigen binding	IBA	molecular function
GO:0004540	ribonuclease activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0006955	immune response	IEA	biological process
GO:0007155	cell adhesion	ISS	biological process
GO:0007155	cell adhesion	IDA	biological process
GO:0008285	negative regulation of cell proliferation	NAS	biological process
GO:0008320	protein transmembrane transporter activity	NAS	molecular function
GO:0019882	antigen processing and presentation	IBA	biological process
GO:0042605	peptide antigen binding	IEA	molecular function
GO:0042612	MHC class I protein complex	IEA	cellular component
GO:0055085	transmembrane transport	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071806	protein transmembrane transport	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0001895	retina homeostasis	IEP	biological process
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0002474	antigen processing and presentation of peptide antigen via MHC class I	IEA	biological process
GO:0003823	antigen binding	IBA	molecular function
GO:0004540	ribonuclease activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0006955	immune response	IEA	biological process
GO:0007155	cell adhesion	ISS	biological process
GO:0007155	cell adhesion	IDA	biological process
GO:0008285	negative regulation of cell proliferation	NAS	biological process
GO:0008320	protein transmembrane transporter activity	NAS	molecular function
GO:0019882	antigen processing and presentation	IBA	biological process
GO:0042605	peptide antigen binding	IEA	molecular function
GO:0042612	MHC class I protein complex	IEA	cellular component
GO:0055085	transmembrane transport	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071806	protein transmembrane transport	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0001895	retina homeostasis	IEP	biological process
GO:0001948	glycoprotein binding	IPI	molecular function
GO:0003823	antigen binding	IBA	molecular function
GO:0004540	ribonuclease activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0007155	cell adhesion	ISS	biological process
GO:0007155	cell adhesion	IDA	biological process
GO:0008285	negative regulation of cell proliferation	NAS	biological process
GO:0008320	protein transmembrane transporter activity	NAS	molecular function
GO:0019882	antigen processing and presentation	IBA	biological process
GO:0055085	transmembrane transport	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

Diseases

Associated diseases	References
Oligoasthenozoospermia	MIK: 8867597
Oligoasthenozoospermia	MIK: 8867597
Oligozoospermia	MIK: 22182811
Oligozoospermia	MIK: 22182811
Male factor infertility	MIK: 22182811
Azoospermia	MIK: 22182811
Female infertility	INFBASE: 24280142
Endometriosis	INFBASE: 24648304
Follicular development	INFBASE: 25595538
Acrosome reaction and sperm motility	MIK: 21790656
Oligoasthenozoospermia	MIK: 8867597
Oligospermia	MIK: 22182811

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
22182811	Oligospermia				Male infertility	Lactoferrin Prostatic acid phosphatase Human Zinc-Alpha-2-Glycoprotein Prostate specific antigen Progestagen-associated endometrial protein Kinesin light chain 4 Kinesin light chain 4 Prolactin inducible protein Izumo sperm-egg fusion protein 1
8867597	Oligo-asthenozoospermia			62 (35 normozoospermic men, 27 asthenozoospermic men, oligozoospermic)	Male infertility	PSA PAP Zn alpha 2-glycoprotein (Zn alpha 2-GP) beta-microseminoprotein (beta-MSP)
21790656	Acrosome reaction and sperm motility				Male infertility