• Gene id: 56288

Gene Summary

• Gene Symbol: PARD3   Gene   UCSC   Ensembl
• Aliases: ASIP, Baz, PAR3, PAR3alpha, PARD-3, PARD3A, PPP1R118, SE2-5L16, SE2-5LT1, SE2-5T2
• Gene name: par-3 family cell polarity regulator
• Alternate names: partitioning defective 3 homolog, CTCL tumor antigen se2-5, PAR3-alpha, atypical PKC isotype-specific interacting protein, bazooka, par-3 family cell polarity regulator alpha, par-3 partitioning defective 3 homolog, protein phosphatase 1, regulatory subunit 118,
• Gene location: 10p11.22-p11.21 (34815324: 34109559)     Exons: 49     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the PARD protein family. PARD family members interact with other PARD family members and other proteins; they affect asymmetrical cell division and direct polarized cell growth. Multiple alternatively spliced transcript varia
• OMIM: 606745

Protein Summary

• Protein general information: Q8TEW0  
  • Name: Partitioning defective 3 homolog (PAR 3) (PARD 3) (Atypical PKC isotype specific interacting protein) (ASIP) (CTCL tumor antigen se2 5) (PAR3 alpha)
  • Length: 1356  
  • Mass: 151423
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRL
  VAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHVRRSSDPALIG
  LSTSVSDSNFSSEEPSRKNPTRWSTTAGFLKQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSAS
  HPMVGKWLEKQEQDEDGTEEDNSRVEPVGHADTGLEHIPNFSLDDMVKLVEVPNDGGPLGIHVVPFSARGGRTLG
  LLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPAANKEQYEQLSQSEKN
  NYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSRLPHSAHPSGKPPSAPASAPQNVFSTTVSSG
  YNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQE
  EVVSLLRSTKMEGTVSLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAG
  LGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRRSMSTEGNKRGM
  IQLIVARRISKCNELKSPGSPPGPELPIETALDDRERRISHSLYSGIEGLDESPSRNAALSRIMGESGKYQLSPT
  VNMPQDDTVIIEDDRLPVLPPHLSDQSSSSSHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGR
  QSMSEKRTKQFSDASQLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEV
  TLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETLEEDTEESSRSGRESVSTASDQPSHSLE
  RQMNGNQEKGDKTDRKKDKTGKEKKKDRDKEKDKMKAKKGMLKGLGDMFRFGKHRKDDKIEKTGKIKIQESFTSE
  EERIRMKQEQERIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDA
  LYAQVKKPRNSKPSPVDSNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQPWPNARPATQSGRHSVSVE
  VQMQRQRQEERESSQQAQRQYSSLPRQSRKNASSVSQDSWEQNYSPGEGFQSAKENPRYSSYQGSRNGYLGGHGF
  NARVMLETQELLRQEQRRKEQQMKKQPPSEGPSNYDSYKKVQDPSYAPPKGPFRQDVPPSPSQVARLNRLQTPEK
  GRPFYS

• Structural information:
  • Protein Domains: (271..35-)
    (/note="PDZ-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (461..54-)
    (/note="PDZ-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (590..67-)
    (/note="PDZ-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143"-)
  • Interpro: IPR021922  IPR001478  IPR036034  
  • Prosite: PS50106
  • PDB: 2KOM
  • PDBsum: 2KOM
  • DIP: 31315
  • STRING: ENSP00000363921
• Other Databases: GeneCards:  PARD3  Malacards:  PARD3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005912	adherens junction	IBA	cellular component
GO:0005938	cell cortex	IBA	cellular component
GO:0030010	establishment of cell polarity	IBA	biological process
GO:0043296	apical junction complex	IBA	cellular component
GO:0051660	establishment of centrosome localization	IBA	biological process
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0007155	cell adhesion	IBA	biological process
GO:0008104	protein localization	IBA	biological process
GO:0016324	apical plasma membrane	IBA	cellular component
GO:0035091	phosphatidylinositol binding	IBA	molecular function
GO:0045197	establishment or maintenance of epithelial cell apical/basal polarity	IBA	biological process
GO:0005911	cell-cell junction	IDA	cellular component
GO:0090162	establishment of epithelial cell polarity	ISS	biological process
GO:0031643	positive regulation of myelination	ISS	biological process
GO:0010801	negative regulation of peptidyl-threonine phosphorylation	ISS	biological process
GO:0005911	cell-cell junction	ISS	cellular component
GO:0070830	bicellular tight junction assembly	ISS	biological process
GO:0033269	internode region of axon	ISS	cellular component
GO:0032266	phosphatidylinositol-3-phosphate binding	ISS	molecular function
GO:0022011	myelination in peripheral nervous system	ISS	biological process
GO:0006612	protein targeting to membrane	ISS	biological process
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	ISS	molecular function
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051301	cell division	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0065003	protein-containing complex assembly	TAS	biological process
GO:0007163	establishment or maintenance of cell polarity	TAS	biological process
GO:0005923	bicellular tight junction	TAS	cellular component
GO:0008356	asymmetric cell division	TAS	biological process
GO:0005923	bicellular tight junction	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007179	transforming growth factor beta receptor signaling pathway	TAS	biological process
GO:0070830	bicellular tight junction assembly	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0030054	cell junction	TAS	cellular component
GO:0030054	cell junction	TAS	cellular component
GO:0030054	cell junction	TAS	cellular component
GO:0030054	cell junction	TAS	cellular component
GO:0030054	cell junction	TAS	cellular component
GO:0030054	cell junction	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090162	establishment of epithelial cell polarity	IEA	biological process
GO:0060341	regulation of cellular localization	IEA	biological process
GO:0044295	axonal growth cone	IEA	cellular component
GO:0032991	protein-containing complex	IEA	cellular component
GO:0005911	cell-cell junction	IEA	cellular component
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IEA	molecular function
GO:0070830	bicellular tight junction assembly	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0032266	phosphatidylinositol-3-phosphate binding	IEA	molecular function
GO:0019903	protein phosphatase binding	IEA	molecular function
GO:0006612	protein targeting to membrane	IEA	biological process
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	IEA	molecular function
GO:0012505	endomembrane system	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0005923	bicellular tight junction	IDA	cellular component
GO:0007409	axonogenesis	TAS	biological process
GO:0005923	bicellular tight junction	ISS	cellular component
GO:0007163	establishment or maintenance of cell polarity	TAS	biological process
GO:0007205	protein kinase C-activating G protein-coupled receptor signaling pathway	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa05165	Human papillomavirus infection
hsa04144	Endocytosis
hsa04015	Rap1 signaling pathway
hsa04062	Chemokine signaling pathway
hsa04360	Axon guidance
hsa04530	Tight junction
hsa04390	Hippo signaling pathway
hsa04520	Adherens junction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq