• Gene id: 56287

Gene Summary

• Gene Symbol: GKN1   Gene   UCSC   Ensembl
• Aliases: AMP18, BRICD1, CA11, FOV, foveolin
• Gene name: gastrokine 1
• Alternate names: gastrokine-1, 18 kDa antrum mucosa protein, BRICHOS domain containing 1,
• Gene location: 2p13.3 (68974635: 68980975)     Exons: 6     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa. [provided by RefSeq, Jul 2008]
• OMIM: 600914

Protein Summary

• Protein general information: Q9NS71  
  • Name: Gastrokine 1 (18 kDa antrum mucosa protein) (AMP 18) (Protein CA11)
  • Length: 199  
  • Mass: 21999
  • Tissue specificity: Expressed in stomach. No expression is detected in cancer tissue or gastric cancer cell lines. {ECO
• Sequence:

  MLAYSSVHCFREDKMKFTIVFAGLLGVFLAPALANYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWN
  SIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGK
  NIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN

• Structural information:
  • Protein Domains: (68..16-)
    (/note="BRICHOS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00255"-)
  • Interpro: IPR007084  
  • Prosite: PS50869
  • STRING: ENSP00000367172
• Other Databases: GeneCards:  GKN1  Malacards:  GKN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042127	regulation of cell population proliferation	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007586	digestion	NAS	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray