• Gene id: 56271

Gene Summary

• Gene Symbol: BEX4   Gene   UCSC   Ensembl
• Aliases: BEXL1
• Gene name: brain expressed X-linked 4
• Alternate names: protein BEX4, BEX family member 4, BEX1-like protein 1, brain expressed X-linked-like 1, nerve growth factor receptor-associated protein 3,
• Gene location: Xq22.1 (103215091: 103217245)     Exons: 3     NC_000023.11
• Gene summary(Entrez): This gene is a member of the brain expressed X-linked gene family. The proteins encoded by some of the other members of this family act as transcription elongation factors which allow RNA polymerase II to escape pausing during elongation. Multiple alterna
• OMIM: 300692

Protein Summary

• Protein general information: Q9NWD9  
  • Name: Protein BEX4 (BEX1 like protein 1) (Brain expressed X linked protein 4) (Nerve growth factor receptor associated protein 3)
  • Length: 120  
  • Mass: 14067
  • Tissue specificity: Very high expression in heart, skeletal muscle, liver, and kidney. The levels of expression are uniform throughout the brain. {ECO
• Sequence:

  MESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRHIEHNE
  ARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDFCLIP

• Structural information:
  • Interpro: IPR007623  IPR021156  
  • STRING: ENSP00000361780
• Other Databases: GeneCards:  BEX4  Malacards:  BEX4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0043014	alpha-tubulin binding	IDA	molecular function
GO:0005874	microtubule	IDA	cellular component
GO:0000922	spindle pole	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0030334	regulation of cell migration	IMP	biological process
GO:0042127	regulation of cell population proliferation	IMP	biological process
GO:1904428	negative regulation of tubulin deacetylation	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)