• Gene id: 5627

Gene Summary

• Gene Symbol: PROS1   Gene   UCSC   Ensembl
• Aliases: PROS, PS21, PS22, PS23, PS24, PS25, PSA, THPH5, THPH6
• Gene name: protein S
• Alternate names: vitamin K-dependent protein S, protein S (alpha), protein Sa, vitamin K-dependent plasma protein S,
• Gene location: 3q11.1 (40587363: 40391588)     Exons: 10     NC_000006.12
• Gene summary(Entrez): This gene encodes a vitamin K-dependent plasma protein that functions as a cofactor for the anticoagulant protease, activated protein C (APC) to inhibit blood coagulation. It is found in plasma in both a free, functionally active form and also in an inact
• OMIM: 176880

Protein Summary

• Protein general information: P07225  
  • Name: Vitamin K dependent protein S
  • Length: 676  
  • Mass: 75123
  • Tissue specificity: Plasma.
• Sequence:

  MRVLGGRCGALLACLLLVLPVSEANFLSKQQASQVLVRKRRANSLLEETKQGNLERECIEELCNKEEAREVFEND
  PETDYFYPKYLVCLRSFQTGLFTAARQSTNAYPDLRSCVNAIPDQCSPLPCNEDGYMSCKDGKASFTCTCKPGWQ
  GEKCEFDINECKDPSNINGGCSQICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFE
  CECPEGYRYNLKSKSCEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL
  YLAEQFAGVVLYLKFRLPEISRFSAEFDFRTYDSEGVILYAESIDHSAWLLIALRGGKIEVQLKNEHTSKITTGG
  DVINNGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLFKPENGLLETKVYFAGFPRKVESELIKPINPRLDGCI
  RSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLA
  LVSGNNTVPFAVSLVDSTSEKSQDILLSVENTVIYRIQALSLCSDQQSHLEFRVNRNNLELSTPLKIETISHEDL
  QRQLAVLDKAMKAKVATYLGGLPDVPFSATPVNAFYNGCMEVNINGVQLDLDEAISKHNDIRAHSCPSVWKKTKN
  S

• Structural information:
  • Protein Domains: (42..8-)
    (/note="Gla-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00463-)
    (117..15-)
    (/note="EGF-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (157..20-)
    (/note="EGF-like-)
    (-)
    (/evidence="ECO:0000255|PROSITE-)
  • Interpro: IPR017857  IPR013320  IPR001881  IPR013032  IPR000742   IPR000152  IPR018097  IPR035972  IPR000294  IPR009030  IPR001791  IPR033189  
  • Prosite: PS00010 PS00022 PS01186 PS50026 PS01187 PS00011 PS50998 PS50025
  • PDB: 1Z6C
  • PDBsum: 1Z6C
  • STRING: ENSP00000377783
• Other Databases: GeneCards:  PROS1  Malacards:  PROS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0030195	negative regulation of blood coagulation	IEA	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007599	hemostasis	IEA	biological process
GO:0042730	fibrinolysis	IEA	biological process
GO:0004866	endopeptidase inhibitor activity	TAS	molecular function
GO:0007596	blood coagulation	TAS	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0030449	regulation of complement activation	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0005576	extracellular region	NAS	cellular component
GO:0072562	blood microparticle	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04610	Complement and coagulation cascades

Diseases

Associated diseases	References
Inherited thrombophilia	KEGG:H00223
Deep vein thrombosis	KEGG:H01723
Inherited thrombophilia	KEGG:H00223
Deep vein thrombosis	KEGG:H01723
Protein S deficiency	PMID:9657428
Cerebral infarction	PMID:21172841
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881