• Gene id: 56255

Gene Summary

• Gene Symbol: TMX4   Gene   UCSC   Ensembl
• Aliases: DJ971N18.2, PDIA14, TXNDC13
• Gene name: thioredoxin related transmembrane protein 4
• Alternate names: thioredoxin-related transmembrane protein 4, protein disulfide isomerase family A, member 14, thioredoxin domain containing 13, thioredoxin domain-containing protein 13,
• Gene location: 20p12.3 (8019760: 7977345)     Exons: 8     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically ac
• OMIM: 616766

Protein Summary

• Protein general information: Q9H1E5  
  • Name: Thioredoxin related transmembrane protein 4 (Thioredoxin domain containing protein 13)
  • Length: 349  
  • Mass: 38952
• Sequence:

  MAGGRCGPQLTALLAAWIAAVAATAGPEEAALPPEQSRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQTDSEWE
  AFAKNGEILQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIFEDLQNYILEKKWQSVEPLTGWK
  SPASLTMSGMAGLFSISGKIWHLHNYFTVTLGIPAWCSYVFFVIATLVFGLFMGLVLVVISECFYVPLPRHLSER
  SEQNRRSEEAHRAEQLQDAEEEKDDSNEEENKDSLVDDEEEKEDLGDEDEAEEEEEEDNLAAGVDEERSEANDQG
  PPGEDGVTREEVEPEEAEEGISEQPCPADTEVVEDSLRQRKSQHADKGL

• Structural information:
  • Protein Domains: (30..13-)
    (/note="Thioredoxin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00691"-)
  • Interpro: IPR036249  IPR017937  IPR013766  
  • Prosite: PS00194 PS51352
  • STRING: ENSP00000246024
• Other Databases: GeneCards:  TMX4  Malacards:  TMX4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005637	nuclear inner membrane	ISS	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005637	nuclear inner membrane	IEA	cellular component
GO:0005637	nuclear inner membrane	IEA	cellular component
GO:0045454	cell redox homeostasis	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881