• Gene id: 56253

Gene Summary

• Gene Symbol: CRTAM   Gene   UCSC   Ensembl
• Aliases: CD355
• Gene name: cytotoxic and regulatory T cell molecule
• Alternate names: cytotoxic and regulatory T-cell molecule, class-I MHC-restricted T-cell-associated molecule,
• Gene location: 11q24.1 (122838418: 122872642)     Exons: 10     NC_000011.10
• Gene summary(Entrez): The CRTAM gene is upregulated in CD4 (see MIM 186940)-positive and CD8 (see CD8A; MIM 186910)-positive T cells and encodes a type I transmembrane protein with V and C1-like Ig domains (Yeh et al., 2008 [PubMed 18329370]).[supplied by OMIM, Feb 2009]
• OMIM: 613369

Protein Summary

• Protein general information: O95727  
  • Name: Cytotoxic and regulatory T cell molecule (Class I MHC restricted T cell associated molecule) (CD antigen CD355)
  • Length: 393  
  • Mass: 44641
  • Tissue specificity: In the immune system, expression is restricted to activated class-I MHC-restricted cells, including NKT and CD8 T-cells (PubMed
• Sequence:

  MWWRVLSLLAWFPLQEASLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLH
  HSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPP
  QITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETAS
  DALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSGILLLTLVSFLIFI
  LFIIVQLFIMKLRKAHVIWKKENEVSEHTLESYRSRSNNEETSSEEKNGQSSHPMRCMNYITKLYSEAKTKRKEN
  VQHSKLEEKHIQVPESIV

• Structural information:
  • Protein Domains: (18..11-)
    (/note="Ig-like-V-type)
    (/evidence="ECO:0000255-)
    (118..21-)
    (/note="Ig-like-C2-type)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR013162  IPR007110  IPR036179  IPR013783  IPR003599   IPR013106  
  • Prosite: PS50835
  • PDB: 3RBG 4H5S
  • PDBsum: 3RBG 4H5S
  • DIP: 60155
  • STRING: ENSP00000227348
• Other Databases: GeneCards:  CRTAM  Malacards:  CRTAM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002860	positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IDA	biological process
GO:0008037	cell recognition	IDA	biological process
GO:0001913	T cell mediated cytotoxicity	IDA	NOT|biological process
GO:0050715	positive regulation of cytokine secretion	IDA	biological process
GO:0002355	detection of tumor cell	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	IDA	biological process
GO:0050798	activated T cell proliferation	IDA	NOT|biological process
GO:0051606	detection of stimulus	IDA	biological process
GO:0002860	positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0008037	cell recognition	IBA	biological process
GO:0002355	detection of tumor cell	IBA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0002860	positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0008037	cell recognition	IEA	biological process
GO:0032729	positive regulation of interferon-gamma production	IEA	biological process
GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	IEA	biological process
GO:0051606	detection of stimulus	IEA	biological process
GO:0001768	establishment of T cell polarity	IEA	biological process
GO:0001772	immunological synapse	IEA	cellular component
GO:0002355	detection of tumor cell	IEA	biological process
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IEA	biological process
GO:0045580	regulation of T cell differentiation	IEA	biological process
GO:0046007	negative regulation of activated T cell proliferation	IEA	biological process
GO:0050863	regulation of T cell activation	IEA	biological process
GO:0097021	lymphocyte migration into lymphoid organs	IEA	biological process
GO:2001185	regulation of CD8-positive, alpha-beta T cell activation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0097021	lymphocyte migration into lymphoid organs	ISS	biological process
GO:0045580	regulation of T cell differentiation	ISS	biological process
GO:2001185	regulation of CD8-positive, alpha-beta T cell activation	ISS	biological process
GO:0046007	negative regulation of activated T cell proliferation	ISS	biological process
GO:0001768	establishment of T cell polarity	ISS	biological process
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	ISS	biological process
GO:0097021	lymphocyte migration into lymphoid organs	ISS	biological process
GO:0050863	regulation of T cell activation	ISS	biological process
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	ISS	biological process
GO:0001772	immunological synapse	ISS	cellular component
GO:0032729	positive regulation of interferon-gamma production	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq