• Gene id: 5623

Gene Summary

• Gene Symbol: PSPN   Gene   UCSC   Ensembl
• Aliases: PSP
• Gene name: persephin
• Alternate names: persephin,
• Gene location: 19p13.3 (6375915: 6375147)     Exons: 2     NC_000019.10
• Gene summary(Entrez): This gene encodes a secreted ligand of the GDNF (glial cell line-derived neurotrophic factor) subfamily and TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature p
• OMIM: 612252

Protein Summary

• Protein general information: O60542  
  • Name: Persephin (PSP)
  • Length: 156  
  • Mass: 16600
• Sequence:

  MAVGKFLLGSLLLLSLQLGQGWGPDARGVPVADGEFSSEQVAKAGGTWLGTHRPLARLRRALSGPCQLWSLTLSV
  AELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAA
  ACGCGG

• Structural information:
  • Interpro: IPR029034  IPR001839  
  • Prosite: PS51362
  • STRING: ENSP00000245810
• Other Databases: GeneCards:  PSPN  Malacards:  PSPN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008083	growth factor activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0030116	glial cell-derived neurotrophic factor receptor binding	IEA	molecular function
GO:0030971	receptor tyrosine kinase binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0007399	nervous system development	TAS	biological process
GO:0007417	central nervous system development	TAS	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0007411	axon guidance	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq