• Gene id: 56180

Gene Summary

• Gene Symbol: MOSPD1   Gene   UCSC   Ensembl
• Aliases: DJ473B4
• Gene name: motile sperm domain containing 1
• Alternate names: motile sperm domain-containing protein 1,
• Gene location: Xq26.3 (79236130: 79327214)     Exons: 11     NC_000005.10
• OMIM: 300674

Protein Summary

• Protein general information: Q9UJG1  
  • Name: Motile sperm domain containing protein 1
  • Length: 213  
  • Mass: 24086
• Sequence:

  MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCV
  DIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRLKEHLTESLFFEQSFQPE
  NRAVSSGPSLLTVFLGVVCIAALMLPTLGDVESLVPLYLHLSVNQKLVAAYILGLITMAILRT

• Structural information:
  • Protein Domains: (16..14-)
    (/note="MSP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00132"-)
  • Interpro: IPR013783  IPR039283  IPR000535  IPR008962  
  • Prosite: PS50202
  • STRING: ENSP00000359819
• Other Databases: GeneCards:  MOSPD1  Malacards:  MOSPD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881