• Gene id: 5618

Gene Summary

• Gene Symbol: PRLR   Gene   UCSC   Ensembl
• Aliases: HPRL, MFAB, RI-PRLR, hPRLrI
• Gene name: prolactin receptor
• Alternate names: prolactin receptor, hPRL receptor, secreted prolactin binding protein,
• Gene location: 5p13.2 (12975106: 12977226)     Exons: 3     NC_000023.11
• Gene summary(Entrez): This gene encodes a receptor for the anterior pituitary hormone, prolactin, and belongs to the type I cytokine receptor family. Prolactin-dependent signaling occurs as the result of ligand-induced dimerization of the prolactin receptor. Several alternativ
• OMIM: 176761

Protein Summary

• Protein general information: P16471  
  • Name: Prolactin receptor (PRL R)
  • Length: 622  
  • Mass: 69,506
• Sequence:

  MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHEC
  PDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIK
  WSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQ
  IPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQD
  FPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFY
  DPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATL
  LNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLP
  KQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSS
  KCRLQLGGLDYLDPACFTHSFH

• Structural information:
  • Protein Domains: Fibronectin (27-128)
    Fibronectin (129-229)
  • Interpro: IPR003961  IPR036116  IPR015152  IPR013783  IPR003528   IPR033230  
  • Prosite: PS50853 PS01352
  • CDD: cd00063
  • PDB: 1BP3 2LFG 2N7I 3D48 3MZG 3N06 3N0P 3NCB 3NCC 3NCE 3NCF 4I18
  • PDBsum: 1BP3 2LFG 2N7I 3D48 3MZG 3N06 3N0P 3NCB 3NCC 3NCE 3NCF 4I18
  • DIP: 288
  • STRING: ENSP00000371432
• Other Databases: GeneCards:  PRLR  Malacards:  PRLR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004925	prolactin receptor activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006694	steroid biosynthetic process	NAS	biological process
GO:0007166	cell surface receptor signaling pathway	NAS	biological process
GO:0007171	activation of transmembrane receptor protein tyrosine kinase activity	IDA	biological process
GO:0007566	embryo implantation	TAS	biological process
GO:0007595	lactation	NAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0017046	peptide hormone binding	IPI	molecular function
GO:0030155	regulation of cell adhesion	IEA	biological process
GO:0030856	regulation of epithelial cell differentiation	IEA	biological process
GO:0031904	endosome lumen	TAS	cellular component
GO:0038161	prolactin signaling pathway	IEA	biological process
GO:0042110	T cell activation	NAS	biological process
GO:0042803	protein homodimerization activity	NAS	molecular function
GO:0042977	activation of JAK2 kinase activity	NAS	biological process
GO:0042978	ornithine decarboxylase activator activity	NAS	molecular function
GO:0043066	negative regulation of apoptotic process	NAS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0060397	JAK-STAT cascade involved in growth hormone signaling pathway	TAS	biological process
GO:0060644	mammary gland epithelial cell differentiation	IEA	biological process
GO:0060736	prostate gland growth	IEA	biological process
GO:0060749	mammary gland alveolus development	IEA	biological process
GO:0004896	cytokine receptor activity	IEA	molecular function
GO:0004925	prolactin receptor activity	IEA	molecular function
GO:0004925	prolactin receptor activity	IEA	molecular function
GO:0004925	prolactin receptor activity	NAS	molecular function
GO:0004925	prolactin receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005622	intracellular	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006694	steroid biosynthetic process	NAS	biological process
GO:0007166	cell surface receptor signaling pathway	NAS	biological process
GO:0007171	activation of transmembrane receptor protein tyrosine kinase activity	IDA	biological process
GO:0007259	JAK-STAT cascade	IEA	biological process
GO:0007566	embryo implantation	TAS	biological process
GO:0007595	lactation	IEA	biological process
GO:0007595	lactation	NAS	biological process
GO:0007595	lactation	TAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0017046	peptide hormone binding	IPI	molecular function
GO:0030155	regulation of cell adhesion	IEA	biological process
GO:0030856	regulation of epithelial cell differentiation	IEA	biological process
GO:0031904	endosome lumen	TAS	cellular component
GO:0038161	prolactin signaling pathway	IEA	biological process
GO:0038161	prolactin signaling pathway	IEA	biological process
GO:0042110	T cell activation	NAS	biological process
GO:0042803	protein homodimerization activity	NAS	molecular function
GO:0042977	activation of JAK2 kinase activity	NAS	biological process
GO:0042978	ornithine decarboxylase activator activity	NAS	molecular function
GO:0043066	negative regulation of apoptotic process	NAS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0060397	JAK-STAT cascade involved in growth hormone signaling pathway	TAS	biological process
GO:0060644	mammary gland epithelial cell differentiation	IEA	biological process
GO:0060736	prostate gland growth	IEA	biological process
GO:0060749	mammary gland alveolus development	IEA	biological process
GO:0061180	mammary gland epithelium development	IEA	biological process
GO:0004925	prolactin receptor activity	NAS	molecular function
GO:0004925	prolactin receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006694	steroid biosynthetic process	NAS	biological process
GO:0007166	cell surface receptor signaling pathway	NAS	biological process
GO:0007171	activation of transmembrane receptor protein tyrosine kinase activity	IDA	biological process
GO:0007566	embryo implantation	TAS	biological process
GO:0007595	lactation	NAS	biological process
GO:0007595	lactation	TAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0017046	peptide hormone binding	IPI	molecular function
GO:0031904	endosome lumen	TAS	cellular component
GO:0042110	T cell activation	NAS	biological process
GO:0042803	protein homodimerization activity	NAS	molecular function
GO:0042977	activation of JAK2 kinase activity	NAS	biological process
GO:0042978	ornithine decarboxylase activator activity	NAS	molecular function
GO:0043066	negative regulation of apoptotic process	NAS	biological process
GO:0060397	JAK-STAT cascade involved in growth hormone signaling pathway	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04080	Neuroactive ligand-receptor interaction
hsa04060	Cytokine-cytokine receptor interaction
hsa04917	Prolactin signaling pathway

Diseases

Associated diseases	References
Cancer (prostate)	GAD: 19574343
Cancer	GAD: 15119991
Cancer (lymphoma)	GAD: 18636124
Cancer (breast)	GAD: 15119991
Multiple sclerosis	GAD: 12559630
Systemic lupus erythematosus (SLE)	GAD: 12559630
Obesity	GAD: 20734064
Autism	GAD: 18207134
Psychological disorders	GAD: 19086053
Several psychiatric disorders	GAD: 19086053
Abortion	GAD: 20716560
Premature ovarian failure (POF)	GAD: 20655519
Hyperprolactinemia	INFBASE: 24195502
Oligomenorrhea	INFBASE: 24195502
Recurrent pregnancy loss (RPL)	INFBASE: 20716560
Ejaculatory dysfunction	MIK: 26817308
Male factor infertility	MIK: 15120973
Endometriosis	INFBASE: 11942880
Childhood-onset mood disorders	GAD: 20547007
Cryptorchidism	MIK: 28606200
Ejaculatory dysfunction	MIK: 26817308
Male infertility	MIK: 15120973
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
15120973	Male infertility			8 testis biopsies	Male infertility	Vim Rad23A Rad23B Gsr Gstp 1 Mgst1 Ace Casp1 Ctsd Prlr Tmsb4 and Zfp-37 Hsp 1 Osp94
26817308	Ejaculatory dysfunction, male infertility				Male infertility	PRL PRLR
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq