• Gene id: 56158

Gene Summary

• Gene Symbol: TEX12   Gene   UCSC   Ensembl
• Gene name: testis expressed 12
• Alternate names: testis-expressed protein 12, testis expressed sequence 12, testis-expressed sequence 12 protein variant 1, testis-expressed sequence 12 protein variant 2, testis-expressed sequence 12 protein variant 3,
• Gene location: 11q23.1 (112167371: 112172555)     Exons: 5     NC_000011.10
• Gene summary(Entrez): This gene is similar to a mouse gene that is expressed in the testis. [provided by RefSeq, Jul 2008]
• OMIM: 301017

Protein Summary

• Protein general information: Q9BXU0  
  • Name: Testis expressed protein 12
  • Length: 123  
  • Mass: 14107
  • Tissue specificity: Testis specific.
• Sequence:

  MMANHLVKPDNRNCKRPRELESPVPDSPQLSSLGKSDSSFSEISGLFYKDEALEKDLNDVSKEINLMLSTYAKLL
  SERAAVDASYIDEIDELFKEANAIENFLIQKREFLRQRFTVIANTLHR

• Structural information:
  • Interpro: IPR029193  
  • PDB: 6HK8 6HK9
  • PDBsum: 6HK8 6HK9
  • STRING: ENSP00000280358
• Other Databases: GeneCards:  TEX12  Malacards:  TEX12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000801	central element	IBA	cellular component
GO:0007130	synaptonemal complex assembly	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000795	synaptonemal complex	IEA	cellular component
GO:0007130	synaptonemal complex assembly	IEA	biological process
GO:0000801	central element	IEA	cellular component
GO:0000711	meiotic DNA repair synthesis	IEA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray