• Gene id: 5613

Gene Summary

• Gene Symbol: PRKX   Gene   UCSC   Ensembl
• Aliases: PKX1
• Gene name: protein kinase X-linked
• Alternate names: cAMP-dependent protein kinase catalytic subunit PRKX, protein kinase PKX1, protein kinase X, serine/threonine-protein kinase PRKX,
• Gene location: Xp22.33 (3713648: 3604339)     Exons: 9     NC_000023.11
• Gene summary(Entrez): This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis. This protein
• OMIM: 300083

Protein Summary

• Protein general information: P51817  
  • Name: cAMP dependent protein kinase catalytic subunit PRKX (PrKX) (Protein kinase X) (Protein kinase X linked) (Serine/threonine protein kinase PRKX) (EC 2.7.11.1) (Protein kinase PKX1)
  • Length: 358  
  • Mass: 40896
  • Tissue specificity: Widely expressed (at protein level). Specifically expressed in blood by macrophages and granulocytes according to PubMed
• Sequence:

  MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFDTLATVGTGTFGRVHLVKEKTAKHFF
  ALKVMSIPDVIRLKQEQHVHNEKSVLKEVSHPFLIRLFWTWHDERFLYMLMEYVPGGELFSYLRNRGRFSSTTGL
  FYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAV
  DWWALGILIFEMLSGFPPFFDDNPFGIYQKILAGKIDFPRHLDFHVKDLIKKLLVVDRTRRLGNMKNGANDVKHH
  RWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWDTAAPVPQKDLEIFKNF

• Structural information:
  • Protein Domains: (49..30-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (304..35-)
    (/note="AGC-kinase-C-terminal")
  • Interpro: IPR000961  IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS51285 PS00107 PS50011 PS00108
  • STRING: ENSP00000262848
• Other Databases: GeneCards:  PRKX  Malacards:  PRKX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005952	cAMP-dependent protein kinase complex	IBA	cellular component
GO:0004691	cAMP-dependent protein kinase activity	IBA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0030334	regulation of cell migration	IDA	biological process
GO:0030155	regulation of cell adhesion	IDA	biological process
GO:0030099	myeloid cell differentiation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0004691	cAMP-dependent protein kinase activity	IDA	molecular function
GO:0004691	cAMP-dependent protein kinase activity	IDA	molecular function
GO:2000696	regulation of epithelial cell differentiation involved in kidney development	IDA	biological process
GO:0060993	kidney morphogenesis	IDA	biological process
GO:0060562	epithelial tube morphogenesis	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0043542	endothelial cell migration	IMP	biological process
GO:0031589	cell-substrate adhesion	IMP	biological process
GO:0001525	angiogenesis	IMP	biological process
GO:0007155	cell adhesion	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0001935	endothelial cell proliferation	IMP	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq