• Gene id: 5612

Gene Summary

• Gene Symbol: THAP12   Gene   UCSC   Ensembl
• Aliases: DAP4, P52rIPK, PRKRIR, THAP0
• Gene name: THAP domain containing 12
• Alternate names: 52 kDa repressor of the inhibitor of the protein kinase, 58 kDa interferon-induced protein kinase-interacting protein, P58IPK-regulatory protein, THAP domain-containing protein 0, THAP domain-containing protein 12, death-associated protein 4, inhibitor of prote,
• Gene location: 11q13.5 (76381131: 76349955)     Exons: 6     NC_000011.10
• OMIM: 155735

Protein Summary

• Protein general information: O43422  
  • Name: 52 kDa repressor of the inhibitor of the protein kinase (p52rIPK) (58 kDa interferon induced protein kinase interacting protein) (p58IPK interacting protein) (Death associated protein 4) (THAP domain containing protein 0) (THAP domain containing protein 1
  • Length: 761  
  • Mass: 87704
• Sequence:

  MPNFCAAPNCTRKSTQSDLAFFRFPRDPARCQKWVENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRTSPYRT
  VLRDNAIPTIFDLTSHLNNPHSRHRKRIKELSEDEIRTLKQKKIDETSEQEQKHKETNNSNAQNPSEEEGEGQDE
  DILPLTLEEKENKEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFETTAV
  NTLFCSKTQQRQMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDESHNLREEFIGFLPYE
  ADAEILAVKFHTMITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAIYTLCSSCALNMWLAKSVPVM
  GVSVALGTIEEVCSFFHRSPQLLLELDNVISVLFQNSKERGKELKEICHSQWTGRHDAFEILVELLQALVLCLDG
  INSDTNIRWNNYIAGRAFVLCSAVSDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAAGSLTAVLHSLNEVM
  ENIEVYHEFWFEEATNLATKLDIQMKLPGKFRRAHQGNLESQLTSESYYKETLSVPTVEHIIQELKDIFSEQHLK
  ALKCLSLVPSVMGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFP
  NVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSEL
  PTDNSETVENT

• Structural information:
  • Interpro: IPR025398  IPR008906  IPR012337  IPR006612  IPR038441  
  • Prosite: PS50950
  • STRING: ENSP00000260045
• Other Databases: GeneCards:  THAP12  Malacards:  THAP12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R