• Gene id: 5610

Gene Summary

• Gene Symbol: EIF2AK2   Gene   UCSC   Ensembl
• Aliases: EIF2AK1, LEUDEN, PKR, PPP1R83, PRKR
• Gene name: eukaryotic translation initiation factor 2 alpha kinase 2
• Alternate names: interferon-induced, double-stranded RNA-activated protein kinase, P1/eIF-2A protein kinase, double stranded RNA activated protein kinase, eIF-2A protein kinase 2, interferon-inducible elF2alpha kinase, p68 kinase, protein kinase R, protein kinase, interferon-ind,
• Gene location: 2p22.2 (37157064: 37099209)     Exons: 17     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a serine/threonine protein kinase that is activated by autophosphorylation after binding to dsRNA. The activated form of the encoded protein can phosphorylate translation initiation factor EIF2S1, which in turn inhibits
• OMIM: 191043

Protein Summary

• Protein general information: P19525  
  • Name: Interferon induced, double stranded RNA activated protein kinase (EC 2.7.11.1) (Eukaryotic translation initiation factor 2 alpha kinase 2) (eIF 2A protein kinase 2) (Interferon inducible RNA dependent protein kinase) (P1/eIF 2A protein kinase) (Protein ki
  • Length: 551  
  • Mass: 62094
  • Tissue specificity: Highly expressed in thymus, spleen and bone marrow compared to non-hematopoietic tissues such as small intestine, liver, or kidney tissues. Colocalizes with GSK3B and TAU in the Alzheimer disease (AD) brain. Elevated levels seen in bre
• Sequence:

  MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEIL
  NKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTK
  QEAKQLAAKLAYLQILSEETSVKSDYLSSGSFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSS
  SLLMNGLRNNQRKAKRSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY
  NNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKCLFIQMEFCDKGTLE
  QWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRTRSKG
  TLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPED
  RPNTSEILRTLTVWKKSPEKNERHTC

• Structural information:
  • Protein Domains: (9..7-)
    (/note="DRBM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00266-)
    (100..16-)
    (/note="DRBM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00266-)
    (267..53-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU001-)
  • Interpro: IPR014720  IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS50137 PS00107 PS50011 PS00108
  • CDD: cd00048
  • PDB: 1QU6 2A19 2A1A 3UIU 6D3K 6D3L
  • PDBsum: 1QU6 2A19 2A1A 3UIU 6D3K 6D3L
  • DIP: 2657
  • STRING: ENSP00000233057
• Other Databases: GeneCards:  EIF2AK2  Malacards:  EIF2AK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004672	protein kinase activity	IBA	molecular function
GO:0004694	eukaryotic translation initiation factor 2alpha kinase activity	IBA	molecular function
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0035455	response to interferon-alpha	IDA	biological process
GO:0017148	negative regulation of translation	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0004672	protein kinase activity	IDA	molecular function
GO:0004672	protein kinase activity	IDA	molecular function
GO:0004672	protein kinase activity	IDA	molecular function
GO:1902036	regulation of hematopoietic stem cell differentiation	ISS	biological process
GO:1902033	regulation of hematopoietic stem cell proliferation	ISS	biological process
GO:0045071	negative regulation of viral genome replication	IMP	biological process
GO:0045071	negative regulation of viral genome replication	IMP	biological process
GO:0032874	positive regulation of stress-activated MAPK cascade	ISS	biological process
GO:0032722	positive regulation of chemokine production	ISS	biological process
GO:0017148	negative regulation of translation	IMP	biological process
GO:0009615	response to virus	IMP	biological process
GO:0001819	positive regulation of cytokine production	ISS	biological process
GO:0034198	cellular response to amino acid starvation	IMP	biological process
GO:1901532	regulation of hematopoietic progenitor cell differentiation	ISS	biological process
GO:1901224	positive regulation of NIK/NF-kappaB signaling	ISS	biological process
GO:1900225	regulation of NLRP3 inflammasome complex assembly	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IMP	molecular function
GO:0000186	activation of MAPKK activity	IMP	biological process
GO:0004694	eukaryotic translation initiation factor 2alpha kinase activity	IMP	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0003725	double-stranded RNA binding	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004694	eukaryotic translation initiation factor 2alpha kinase activity	TAS	molecular function
GO:0019888	protein phosphatase regulator activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0017148	negative regulation of translation	IMP	biological process
GO:0005840	ribosome	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030683	mitigation of host immune response by virus	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001819	positive regulation of cytokine production	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0030968	endoplasmic reticulum unfolded protein response	IEA	biological process
GO:0032722	positive regulation of chemokine production	IEA	biological process
GO:0032874	positive regulation of stress-activated MAPK cascade	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0045071	negative regulation of viral genome replication	IEA	biological process
GO:0046777	protein autophosphorylation	IEA	biological process
GO:1902033	regulation of hematopoietic stem cell proliferation	IEA	biological process
GO:1902036	regulation of hematopoietic stem cell differentiation	IEA	biological process
GO:0003725	double-stranded RNA binding	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:1900225	regulation of NLRP3 inflammasome complex assembly	IEA	biological process
GO:1901224	positive regulation of NIK/NF-kappaB signaling	IEA	biological process
GO:1901532	regulation of hematopoietic progenitor cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0010998	regulation of translational initiation by eIF2 alpha phosphorylation	IEA	biological process
GO:0010998	regulation of translational initiation by eIF2 alpha phosphorylation	IEA	biological process
GO:0010998	regulation of translational initiation by eIF2 alpha phosphorylation	IEA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0033689	negative regulation of osteoblast proliferation	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0046777	protein autophosphorylation	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05203	Viral carcinogenesis
hsa04141	Protein processing in endoplasmic reticulum
hsa05169	Epstein-Barr virus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04217	Necroptosis
hsa05164	Influenza A
hsa05160	Hepatitis C
hsa05162	Measles

Diseases

Associated diseases	References
Alzheimer's disease	PMID:15567511
Huntington's disease	PMID:11468270
Huntington's disease	PMID:15567511
Parkinson's disease	PMID:15567511
Amyotrophic lateral sclerosis	PMID:12675919
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray