• Gene id: 5609

Gene Summary

• Gene Symbol: MAP2K7   Gene   UCSC   Ensembl
• Aliases: JNKK2, MAPKK7, MEK, MEK 7, MKK7, PRKMK7, SAPKK-4, SAPKK4
• Gene name: mitogen-activated protein kinase kinase 7
• Alternate names: dual specificity mitogen-activated protein kinase kinase 7, JNK-activating kinase 2, MAP kinase kinase 7, MAPK/ERK kinase 7, SAPK kinase 4, c-Jun N-terminal kinase kinase 2, stress-activated protein kinase kinase 4,
• Gene location: 19p13.2 (7903784: 7914477)     Exons: 18     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically activates MAPK8/JNK1 and MAPK9/JNK2, and this kinase itself is phosphorylated and activated by MAP kinase kinase k
• OMIM: 603014

Protein Summary

• Protein general information: O14733  
  • Name: Dual specificity mitogen activated protein kinase kinase 7 (MAP kinase kinase 7) (MAPKK 7) (EC 2.7.12.2) (JNK activating kinase 2) (MAPK/ERK kinase 7) (MEK 7) (Stress activated protein kinase kinase 4) (SAPK kinase 4) (SAPKK 4) (SAPKK4) (c Jun N terminal
  • Length: 419  
  • Mass: 47485
  • Tissue specificity: Ubiquitous; with highest level of expression in skeletal muscle. Isoform 3 is found at low levels in placenta, fetal liver, and skeletal muscle. {ECO
• Sequence:

  MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSESSPQHPTPPARPRHML
  GLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQ
  MRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVA
  IVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYD
  IRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLL
  EHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR

• Structural information:
  • Protein Domains: (120..38-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR008271  
  • Prosite: PS50011 PS00108
  • PDB: 2DYL 3WZU 4UX9 5B2K 5B2L 5B2M 5Y8U 5Y90 5Z1D 5Z1E 6IB0 6IB2 6QFL 6QFR 6QFT 6QG4 6QG7 6QHO 6QHR
  • PDBsum: 2DYL 3WZU 4UX9 5B2K 5B2L 5B2M 5Y8U 5Y90 5Z1D 5Z1E 6IB0 6IB2 6QFL 6QFR 6QFT 6QG4 6QG7 6QHO 6QHR
  • STRING: ENSP00000381070
• Other Databases: GeneCards:  MAP2K7  Malacards:  MAP2K7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0008545	JUN kinase kinase activity	IBA	molecular function
GO:0032147	activation of protein kinase activity	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0004708	MAP kinase kinase activity	IBA	molecular function
GO:0007257	activation of JUN kinase activity	IBA	biological process
GO:0023014	signal transduction by protein phosphorylation	IBA	biological process
GO:0031098	stress-activated protein kinase signaling cascade	IBA	biological process
GO:0000187	activation of MAPK activity	IBA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0004708	MAP kinase kinase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007254	JNK cascade	TAS	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:1904355	positive regulation of telomere capping	IMP	biological process
GO:0051973	positive regulation of telomerase activity	IMP	biological process
GO:0019903	protein phosphatase binding	ISS	molecular function
GO:0007257	activation of JUN kinase activity	ISS	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0034612	response to tumor necrosis factor	IDA	biological process
GO:0009408	response to heat	IDA	biological process
GO:0009411	response to UV	IDA	biological process
GO:0051403	stress-activated MAPK cascade	IDA	biological process
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0006970	response to osmotic stress	IDA	biological process
GO:0004708	MAP kinase kinase activity	IDA	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa04010	MAPK signaling pathway
hsa05132	Salmonella infection
hsa05170	Human immunodeficiency virus 1 infection
hsa04141	Protein processing in endoplasmic reticulum
hsa05169	Epstein-Barr virus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04530	Tight junction
hsa05161	Hepatitis B
hsa04380	Osteoclast differentiation
hsa05418	Fluid shear stress and atherosclerosis
hsa05135	Yersinia infection
hsa04926	Relaxin signaling pathway
hsa04722	Neurotrophin signaling pathway
hsa04668	TNF signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04620	Toll-like receptor signaling pathway
hsa04912	GnRH signaling pathway
hsa04012	ErbB signaling pathway
hsa04664	Fc epsilon RI signaling pathway

Diseases

Associated diseases	References
prostate carcinoma in situ	PMID:17577251
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq