• Gene id: 5608

Gene Summary

• Gene Symbol: MAP2K6   Gene   UCSC   Ensembl
• Aliases: MAPKK6, MEK6, MKK6, PRKMK6, SAPKK-3, SAPKK3
• Gene name: mitogen-activated protein kinase kinase 6
• Alternate names: dual specificity mitogen-activated protein kinase kinase 6, MAPK/ERK kinase 6, MAPKK 6, MEK 6, SAPK kinase 3, protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6), stress-activated protein kinase kinase 3,
• Gene location: 17q24.3 (69414696: 69553864)     Exons: 15     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multipl
• OMIM: 608164

Protein Summary

• Protein general information: P52564  
  • Name: Dual specificity mitogen activated protein kinase kinase 6 (MAP kinase kinase 6) (MAPKK 6) (EC 2.7.12.2) (MAPK/ERK kinase 6) (MEK 6) (Stress activated protein kinase kinase 3) (SAPK kinase 3) (SAPKK 3) (SAPKK3)
  • Length: 334  
  • Mass: 37492
  • Tissue specificity: Isoform 2 is only expressed in skeletal muscle. Isoform 1 is expressed in skeletal muscle, heart, and in lesser extent in liver or pancreas. {ECO
• Sequence:

  MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPS
  GQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTI
  PEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERI
  NPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSK
  ERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

• Structural information:
  • Protein Domains: (53..31-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 2Y8O 3ENM 3FME 3VN9 5ETF
  • PDBsum: 2Y8O 3ENM 3FME 3VN9 5ETF
  • DIP: 31346
  • STRING: ENSP00000468348
• Other Databases: GeneCards:  MAP2K6  Malacards:  MAP2K6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0004708	MAP kinase kinase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0032147	activation of protein kinase activity	IBA	biological process
GO:0000187	activation of MAPK activity	IBA	biological process
GO:0023014	signal transduction by protein phosphorylation	IBA	biological process
GO:0031098	stress-activated protein kinase signaling cascade	IBA	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0004708	MAP kinase kinase activity	TAS	molecular function
GO:0006975	DNA damage induced protein phosphorylation	TAS	biological process
GO:0007050	cell cycle arrest	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0004708	MAP kinase kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004708	MAP kinase kinase activity	TAS	molecular function
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0070423	nucleotide-binding oligomerization domain containing signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0072709	cellular response to sorbitol	IEA	biological process
GO:0032308	positive regulation of prostaglandin secretion	IEA	biological process
GO:0002931	response to ischemia	IEA	biological process
GO:0000187	activation of MAPK activity	IEA	biological process
GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0022602	ovulation cycle process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0004708	MAP kinase kinase activity	IEA	molecular function
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0120163	negative regulation of cold-induced thermogenesis	IEA	biological process
GO:0060048	cardiac muscle contraction	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0000165	MAPK cascade	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0000187	activation of MAPK activity	IDA	biological process
GO:0004708	MAP kinase kinase activity	IDA	molecular function
GO:0000187	activation of MAPK activity	IDA	biological process
GO:0004708	MAP kinase kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0004708	MAP kinase kinase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0032147	activation of protein kinase activity	IBA	biological process
GO:0000187	activation of MAPK activity	IBA	biological process
GO:0023014	signal transduction by protein phosphorylation	IBA	biological process
GO:0031098	stress-activated protein kinase signaling cascade	IBA	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0004708	MAP kinase kinase activity	TAS	molecular function
GO:0006975	DNA damage induced protein phosphorylation	TAS	biological process
GO:0007050	cell cycle arrest	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0004708	MAP kinase kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004708	MAP kinase kinase activity	TAS	molecular function
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0070423	nucleotide-binding oligomerization domain containing signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0072709	cellular response to sorbitol	IEA	biological process
GO:0032308	positive regulation of prostaglandin secretion	IEA	biological process
GO:0002931	response to ischemia	IEA	biological process
GO:0000187	activation of MAPK activity	IEA	biological process
GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0022602	ovulation cycle process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0004708	MAP kinase kinase activity	IEA	molecular function
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0120163	negative regulation of cold-induced thermogenesis	IEA	biological process
GO:0060048	cardiac muscle contraction	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0000165	MAPK cascade	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0000187	activation of MAPK activity	IDA	biological process
GO:0004708	MAP kinase kinase activity	IDA	molecular function
GO:0000187	activation of MAPK activity	IDA	biological process
GO:0004708	MAP kinase kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa05132	Salmonella infection
hsa04015	Rap1 signaling pathway
hsa05163	Human cytomegalovirus infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05169	Epstein-Barr virus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04218	Cellular senescence
hsa05161	Hepatitis B
hsa04380	Osteoclast differentiation
hsa05418	Fluid shear stress and atherosclerosis
hsa05135	Yersinia infection
hsa04935	Growth hormone synthesis, secretion and action
hsa04668	TNF signaling pathway
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04620	Toll-like receptor signaling pathway
hsa05145	Toxoplasmosis
hsa04912	GnRH signaling pathway
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa04664	Fc epsilon RI signaling pathway
hsa05014	Amyotrophic lateral sclerosis
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Pick's disease	PMID:12392790
restrictive cardiomyopathy	PMID:11593045
ovarian carcinoma	PMID:16489030
cervical cancer	PMID:20980434
progressive supranuclear palsy	PMID:12392790
prostate carcinoma in situ	PMID:17577251
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq