• Gene id: 5607

Gene Summary

• Gene Symbol: MAP2K5   Gene   UCSC   Ensembl
• Aliases: HsT17454, MAPKK5, MEK5, PRKMK5
• Gene name: mitogen-activated protein kinase kinase 5
• Alternate names: dual specificity mitogen-activated protein kinase kinase 5, MAP kinase kinase 5, MAP kinase kinase MEK5b, MAPK/ERK kinase 5, MAPKK 5, MEK 5,
• Gene location: 15q23 (67542684: 67807113)     Exons: 27     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically interacts with and activates MAPK7/ERK5. This kinase itself can be phosphorylated and activated by MAP3K3/MEKK3, a
• OMIM: 616010

Protein Summary

• Protein general information: Q13163  
  • Name: Dual specificity mitogen activated protein kinase kinase 5 (MAP kinase kinase 5) (MAPKK 5) (EC 2.7.12.2) (MAPK/ERK kinase 5) (MEK 5)
  • Length: 448  
  • Mass: 50112
  • Tissue specificity: Expressed in many adult tissues. Abundant in heart and skeletal muscle.
• Sequence:

  MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSD
  EEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSDSLPSNSLKKSSA
  ELKKILANGQMNEQDIRYRDTLGHGNGGTVYKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYII
  GFYGAFFVENRISICTEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
  DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQKNQGSLMPLQLLQCI
  VDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIVQFNDGNAAVVSMWVCRALEERRSQQGPP

• Structural information:
  • Protein Domains: (18..10-)
    (/note="PB1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01081-)
    (166..40-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000270  IPR034851  IPR000719  IPR017441   IPR008271  
  • Prosite: PS51745 PS00107 PS50011 PS00108
  • CDD: cd06395
  • PDB: 2NPT 2O2V 4IC7
  • PDBsum: 2NPT 2O2V 4IC7
  • DIP: 27558
  • STRING: ENSP00000178640
• Other Databases: GeneCards:  MAP2K5  Malacards:  MAP2K5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000187	activation of MAPK activity	IBA	biological process
GO:0023014	signal transduction by protein phosphorylation	IBA	biological process
GO:0031098	stress-activated protein kinase signaling cascade	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0004708	MAP kinase kinase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0032147	activation of protein kinase activity	IBA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0004708	MAP kinase kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000342	negative regulation of chemokine (C-X-C motif) ligand 2 production	IEA	biological process
GO:0090051	negative regulation of cell migration involved in sprouting angiogenesis	IEA	biological process
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0070375	ERK5 cascade	IEA	biological process
GO:0051247	positive regulation of protein metabolic process	IEA	biological process
GO:0050679	positive regulation of epithelial cell proliferation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0000187	activation of MAPK activity	IEA	biological process
GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0060761	negative regulation of response to cytokine stimulus	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045415	negative regulation of interleukin-8 biosynthetic process	IEA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0034115	negative regulation of heterotypic cell-cell adhesion	IEA	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0030307	positive regulation of cell growth	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0005819	spindle	IEA	cellular component
GO:0000165	MAPK cascade	IEA	biological process
GO:0000187	activation of MAPK activity	ISS	biological process
GO:0051247	positive regulation of protein metabolic process	ISS	biological process
GO:0071363	cellular response to growth factor stimulus	ISS	biological process
GO:0071499	cellular response to laminar fluid shear stress	TAS	biological process
GO:0090051	negative regulation of cell migration involved in sprouting angiogenesis	ISS	biological process
GO:2000342	negative regulation of chemokine (C-X-C motif) ligand 2 production	ISS	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	ISS	biological process
GO:0034115	negative regulation of heterotypic cell-cell adhesion	ISS	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	ISS	biological process
GO:0045415	negative regulation of interleukin-8 biosynthetic process	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0060761	negative regulation of response to cytokine stimulus	ISS	biological process
GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	ISS	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04921	Oxytocin signaling pathway
hsa05418	Fluid shear stress and atherosclerosis
hsa04722	Neurotrophin signaling pathway
hsa04540	Gap junction
P06959	CCKR signaling map

Diseases

Associated diseases	References
Prostate cancer	PMID:12618764
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq