• Gene id: 5606

Gene Summary

• Gene Symbol: MAP2K3   Gene   UCSC   Ensembl
• Aliases: MAPKK3, MEK3, MKK3, PRKMK3, SAPKK-2, SAPKK2
• Gene name: mitogen-activated protein kinase kinase 3
• Alternate names: dual specificity mitogen-activated protein kinase kinase 3, MAP kinase kinase 3, MAPK/ERK kinase 3, MAPKK 3, MEK 3, SAPK kinase 2, stress-activated protein kinase kinase 2,
• Gene location: 17p11.2 (21284678: 21315239)     Exons: 16     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphory
• OMIM: 602315

Protein Summary

• Protein general information: P46734  
  • Name: Dual specificity mitogen activated protein kinase kinase 3 (MAP kinase kinase 3) (MAPKK 3) (EC 2.7.12.2) (MAPK/ERK kinase 3) (MEK 3) (Stress activated protein kinase kinase 2) (SAPK kinase 2) (SAPKK 2) (SAPKK2)
  • Length: 347  
  • Mass: 39318
  • Tissue specificity: Abundant expression is seen in the skeletal muscle. It is also widely expressed in other tissues.
• Sequence:

  MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAY
  GVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKF
  YRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDA
  GCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
  FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS

• Structural information:
  • Protein Domains: (64..32-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • DIP: 34242
  • STRING: ENSP00000345083
• Other Databases: GeneCards:  MAP2K3  Malacards:  MAP2K3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032147	activation of protein kinase activity	IBA	biological process
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004708	MAP kinase kinase activity	IBA	molecular function
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0031098	stress-activated protein kinase signaling cascade	IBA	biological process
GO:0023014	signal transduction by protein phosphorylation	IBA	biological process
GO:0000187	activation of MAPK activity	IBA	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004708	MAP kinase kinase activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0004708	MAP kinase kinase activity	IEA	molecular function
GO:0035331	negative regulation of hippo signaling	IMP	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000165	MAPK cascade	IEA	biological process
GO:0004708	MAP kinase kinase activity	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0060048	cardiac muscle contraction	IEA	biological process
GO:0000187	activation of MAPK activity	IEA	biological process
GO:0042035	regulation of cytokine biosynthetic process	IEA	biological process
GO:0043536	positive regulation of blood vessel endothelial cell migration	IMP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IMP	biological process
GO:0038066	p38MAPK cascade	IMP	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045860	positive regulation of protein kinase activity	IDA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04714	Thermogenesis
hsa05132	Salmonella infection
hsa04015	Rap1 signaling pathway
hsa05170	Human immunodeficiency virus 1 infection
hsa05169	Epstein-Barr virus infection
hsa04218	Cellular senescence
hsa05161	Hepatitis B
hsa05135	Yersinia infection
hsa04935	Growth hormone synthesis, secretion and action
hsa04668	TNF signaling pathway
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04620	Toll-like receptor signaling pathway
hsa05145	Toxoplasmosis
hsa04912	GnRH signaling pathway
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa04664	Fc epsilon RI signaling pathway
hsa05014	Amyotrophic lateral sclerosis

Diseases

Associated diseases	References
Breast cancer	PMID:12618338
Breast cancer	PMID:24233520
colon cancer	PMID:24233520
Glioblastoma multiforme	PMID:17406030
Astrocytoma	PMID:17406030
restrictive cardiomyopathy	PMID:11593045
cervical cancer	PMID:20980434
liver benign neoplasm	PMID:24233520
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray