• Gene id: 5602

Gene Summary

• Gene Symbol: MAPK10   Gene   UCSC   Ensembl
• Aliases: JNK3, JNK3A, PRKM10, SAPK1b, p493F12, p54bSAPK
• Gene name: mitogen-activated protein kinase 10
• Alternate names: mitogen-activated protein kinase 10, JNK3 alpha protein kinase, MAP kinase 10, MAP kinase p49 3F12, c-Jun N-terminal kinase 3, stress activated protein kinase beta, stress-activated protein kinase 1b, stress-activated protein kinase JNK3,
• Gene location: 4q21.3 (86594624: 86010404)     Exons: 27     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as integration points for multiple biochemical signals, and thus are involved in a wide variety of cellular processes, such as proliferation, differentiation, transcrip
• OMIM: 606303

Protein Summary

• Protein general information: P53779  
  • Name: Mitogen activated protein kinase 10 (MAP kinase 10) (MAPK 10) (EC 2.7.11.24) (MAP kinase p49 3F12) (Stress activated protein kinase 1b) (SAPK1b) (Stress activated protein kinase JNK3) (c Jun N terminal kinase 3)
  • Length: 464  
  • Mass: 52585
  • Tissue specificity: Specific to a subset of neurons in the nervous system. Present in the hippocampus and areas, cerebellum, striatum, brain stem, and weakly in the spinal cord. Very weak expression in testis and kidney.
• Sequence:

  MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQ
  GIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMD
  ANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVV
  TRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
  RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQI
  YDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTD
  SSLEASAGPLGCCR

• Structural information:
  • Protein Domains: (64..35-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR003527  IPR008351  IPR000719  IPR008271  
  • Prosite: PS01351 PS50011 PS00108
  • PDB: 1JNK 1PMN 1PMU 1PMV 2B1P 2EXC 2O0U 2O2U 2OK1 2P33 2R9S 2WAJ 2ZDT 2ZDU 3CGF 3CGO 3DA6 3FI2 3FI3 3FV8 3G90 3G9L 3G9N 3KVX 3OXI 3OY1 3PTG 3RTP 3TTI 3TTJ 3V6R 3V6S 4H36 4H39 4H3B 4KKE 4KKG 4KKH 4U79 4W4V 4W4W 4W4X 4W4Y 4WHZ 4X21 4Y46 4Y5H 4Z9L 6EKD 6EMH 6EQ9
  • PDBsum: 1JNK 1PMN 1PMU 1PMV 2B1P 2EXC 2O0U 2O2U 2OK1 2P33 2R9S 2WAJ 2ZDT 2ZDU 3CGF 3CGO 3DA6 3FI2 3FI3 3FV8 3G90 3G9L 3G9N 3KVX 3OXI 3OY1 3PTG 3RTP 3TTI 3TTJ 3V6R 3V6S 4H36 4H39 4H3B 4KKE 4KKG 4KKH 4U79 4W4V 4W4W 4W4X 4W4Y 4WHZ 4X21 4Y46 4Y5H 4Z9L 6EKD 6EMH 6EQ9
  • DIP: 1015
  • STRING: ENSP00000352157
• Other Databases: GeneCards:  MAPK10  Malacards:  MAPK10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0004707	MAP kinase activity	IBA	molecular function
GO:0007254	JNK cascade	IBA	biological process
GO:0004705	JUN kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0009416	response to light stimulus	ISS	biological process
GO:0006468	protein phosphorylation	ISS	biological process
GO:0006468	protein phosphorylation	IMP	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0005739	mitochondrion	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0048511	rhythmic process	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004705	JUN kinase activity	TAS	molecular function
GO:0004708	MAP kinase kinase activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007254	JNK cascade	TAS	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0051090	regulation of DNA-binding transcription factor activity	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0071474	cellular hyperosmotic response	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0009414	response to water deprivation	IEA	biological process
GO:0007254	JNK cascade	IEA	biological process
GO:0099003	vesicle-mediated transport in synapse	IEA	biological process
GO:0098969	neurotransmitter receptor transport to postsynaptic membrane	IEA	biological process
GO:0043204	perikaryon	IEA	cellular component
GO:0007258	JUN phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0004705	JUN kinase activity	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000187	activation of MAPK activity	IEA	biological process
GO:0004705	JUN kinase activity	ISS	molecular function
GO:0007254	JNK cascade	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa04010	MAPK signaling pathway
hsa05012	Parkinson disease
hsa05131	Shigellosis
hsa04014	Ras signaling pathway
hsa05132	Salmonella infection
hsa04024	cAMP signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa04510	Focal adhesion
hsa05130	Pathogenic Escherichia coli infection
hsa05170	Human immunodeficiency virus 1 infection
hsa04141	Protein processing in endoplasmic reticulum
hsa05169	Epstein-Barr virus infection
hsa04310	Wnt signaling pathway
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04530	Tight junction
hsa04621	NOD-like receptor signaling pathway
hsa04723	Retrograde endocannabinoid signaling
hsa05017	Spinocerebellar ataxia
hsa04140	Autophagy - animal
hsa05152	Tuberculosis
hsa04217	Necroptosis
hsa04932	Non-alcoholic fatty liver disease
hsa04910	Insulin signaling pathway
hsa05161	Hepatitis B
hsa04728	Dopaminergic synapse
hsa04380	Osteoclast differentiation
hsa05418	Fluid shear stress and atherosclerosis
hsa05135	Yersinia infection
hsa04210	Apoptosis
hsa04926	Relaxin signaling pathway
hsa04722	Neurotrophin signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04068	FoxO signaling pathway
hsa04935	Growth hormone synthesis, secretion and action
hsa05162	Measles
hsa05231	Choline metabolism in cancer
hsa04668	TNF signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04931	Insulin resistance
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04659	Th17 cell differentiation
hsa04620	Toll-like receptor signaling pathway
hsa05145	Toxoplasmosis
hsa04914	Progesterone-mediated oocyte maturation
hsa04912	GnRH signaling pathway
hsa05142	Chagas disease
hsa04658	Th1 and Th2 cell differentiation
hsa04012	ErbB signaling pathway
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa01522	Endocrine resistance
hsa04657	IL-17 signaling pathway
hsa04137	Mitophagy - animal
hsa05210	Colorectal cancer
hsa05120	Epithelial cell signaling in Helicobacter pylori infection
hsa04622	RIG-I-like receptor signaling pathway
hsa04920	Adipocytokine signaling pathway
hsa04664	Fc epsilon RI signaling pathway
hsa05212	Pancreatic cancer
hsa05133	Pertussis
hsa04917	Prolactin signaling pathway
hsa04930	Type II diabetes mellitus
hsa04215	Apoptosis - multiple species
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Semen quality	MIK: 26209830
Sperm motility	MIK: 26209830
Male factor infertility	MIK: 26209830
Lennox-Gastaut syndrome	KEGG:H01813
Lennox-Gastaut syndrome	KEGG:H01813
Alzheimer's disease	PMID:11208906
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq